KEGG   Geobacillus thermocatenulatus: GT3921_03415Help
Entry
GT3921_03415      CDS       T05178                                 

Definition
(GenBank) hypothetical protein
Organism
gtm  Geobacillus thermocatenulatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASS98182
UniProt: A0A226QBN4
LinkDB All DBs
Position
690074..690628
Genome map
AA seq 184 aa AA seqDB search
MRIPQLRMEATYAKLAISSERARLDITQPPAEMTIEQPPADMRIAAIPARLTIDQTEAWA
AVNNKHVFRLIEDAAADGRQAVLDFIERAAIQGDELMRIEYGGDPLVEQAEANSEGPPLE
LGIALVPPPFSVKVDYEPGRLAIDWNTYAPRIDVKPHAPIIRYQQGAVKIDLAQRPSLHI
DVVI
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattccgcagcttaggatggaagcgacgtacgccaagctggcgatctcaagcgaa
cgggcgcggcttgacatcacccagccgcccgcggagatgacgatcgagcaaccgcccgct
gacatgcgcatcgccgccattcccgcccgcctgacgatcgaccagaccgaggcgtgggcg
gcggtcaacaacaagcacgtgtttcggctgatcgaagacgcggccgctgacggacggcaa
gcggtgctcgacttcatcgagcgcgccgccattcaaggcgatgaactgatgcgcattgaa
tacggcggtgatcccctcgtggaacaggcggaggccaacagcgaaggcccgccgcttgag
ttgggcatcgccctcgtcccgccgccgtttagcgtcaaggtcgactatgaaccgggaagg
ctggcgatcgactggaacacctacgcgccccgcatcgatgtgaaaccgcatgcgccgatc
atccgctaccagcaaggggcggtcaagatcgatctcgcccagcgtccgtcgcttcacatt
gacgttgtcatttga

DBGET integrated database retrieval system