KEGG   Geobacillus thermocatenulatus: GT3921_05230Help
Entry
GT3921_05230      CDS       T05178                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
gtm  Geobacillus thermocatenulatus
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gtm01002]
    GT3921_05230
Enzymes [BR:gtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GT3921_05230
Peptidases [BR:gtm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GT3921_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ASS98487
UniProt: A0A226QCS9
LinkDB All DBs
Position
1043773..1045413
Genome map
AA seq 546 aa AA seqDB search
MNKRAMLGAIGLAVGLMAWPLGASAKEKSIVWNEQWKTPSFVSGSLLKGEEAPEQLVYRY
LDQEKNTFQLGGQARERLSLIGKQVDELGHTVMRFEQRYHGIPVYGAVLVAHVNDGELSS
LSGALIPNLDKQTLKTKAAISVQQAERIAKQDVVDAVTNEWPAFEVGKSTRLVIYPDGED
ARLAYEVNVRFLTPVPGNWIYMVDATDGRVLDKWNQMDEAKPDGGQPVAGTSTVGVGRGV
LGDQKYINTTYSSYDGYYYLQDNTRGSGIFTYDGRNRTTLPGSLWADSDNQFFASYDTAA
VDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQTF
LPFSGGIDVVAHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGE
DIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVH
YGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAF
NAVGVY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgcttggcgcgattgggttggcggttggattgatggcttggccg
ctcggcgcttcggcgaaggaaaaatcaatagtatggaacgaacagtggaagacgccatcg
ttcgtttcgggttcgctgttaaaaggcgaggaagctccggaacaattggtttaccgttat
cttgatcaagagaagaatacgttccagcttggtggacaagcccgtgaacggctgagcttg
attggcaaacaagtggatgaactcggccatacggtcatgcgttttgaacagcgctatcac
ggcatccccgtgtatggcgccgtgcttgttgcccatgtcaacgatggcgaattgtcctct
ttgtcgggcgcgctcattccgaatttggacaaacaaacgttgaaaacaaaagccgccatt
tccgttcaacaagcggaaaggatcgcgaaacaagatgtggtggatgcagtgacgaacgaa
tggccggctttcgaagtgggaaaatcaacgcggcttgtcatctatccggatggggaggac
gcacgcctcgcttatgaagtcaatgtccgctttttaacccctgtgccaggcaactggatc
tacatggttgatgctacagacggaagagtgttagataaatggaaccaaatggacgaggca
aagccggacggcgggcagccggtcgccggtacgtcgacagtcggcgtgggccgcggtgtg
ttgggcgatcagaaatatatcaatacgacgtactcttcgtatgacggttattactatttg
caagacaatacacgcggcagcggcatttttacgtatgacggacgaaaccgcactacactg
cccggcagcttatgggccgatagcgacaaccaatttttcgccagctatgacacggcggcg
gtggacgcccattattacgccggcgtcgtgtatgattattacaaaaatgtacacggccgg
ctgagctatgacggcagcaacgccgccatccgttcgaccgttcattacggccgcggctat
aacaacgcgttttggaacggttcgcaaatggtgtacggcgatggagatggacagacgttt
ttgccgttttccggaggcattgatgtcgtcgctcatgagttgacccacgccgtgaccgat
tataccgccgggttggtgtaccaaaacgagtccggtgcgatcaatgaagcgatgtccgat
attttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggcgaa
gacatttacacgcctgggatcgccggcgatgcgctccgctcgatgtccgacccggcgaaa
tacggcgatccggatcattattcgaaacggtacaccggcacgcaagacaacggcggcgtc
catacaaacagcggcatcatcaataaagcggcgtacttgctcagccaaggaggcgtccat
tacggcgtgagcgtcaccggcatcggccgcgacaaaatggggaaaattttctaccgggcg
cttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgcgtgcaa
gcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacaggcgttc
aatgcggttggcgtgtattaa

DBGET integrated database retrieval system