KEGG   Geobacillus thermocatenulatus: GT3921_05730Help
Entry
GT3921_05730      CDS       T05178                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00010  Glycolysis / Gluconeogenesis
gtm00030  Pentose phosphate pathway
gtm00051  Fructose and mannose metabolism
gtm00052  Galactose metabolism
gtm00680  Methane metabolism
gtm01100  Metabolic pathways
gtm01110  Biosynthesis of secondary metabolites
gtm01120  Microbial metabolism in diverse environments
gtm01130  Biosynthesis of antibiotics
gtm01200  Carbon metabolism
gtm01230  Biosynthesis of amino acids
gtm03018  RNA degradation
Module
gtm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3921_05730
   00030 Pentose phosphate pathway
    GT3921_05730
   00051 Fructose and mannose metabolism
    GT3921_05730
   00052 Galactose metabolism
    GT3921_05730
  09102 Energy metabolism
   00680 Methane metabolism
    GT3921_05730
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GT3921_05730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gtm01009]
    GT3921_05730
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gtm03019]
    GT3921_05730
Enzymes [BR:gtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GT3921_05730
Protein phosphatases and associated proteins [BR:gtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GT3921_05730
Messenger RNA biogenesis [BR:gtm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GT3921_05730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: AST00848
UniProt: A0A1V9BWU4
LinkDB All DBs
Position
1154094..1155053
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcaactgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgattttacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgacatcgcgctatggtcg
gggcttgccggaggggcggagaccattttgattccggaagcggactacgacatggacgac
atcatcgcccgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccatgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgtggaccatgacattgccgaagcgttg
gcgaaaacccatacggtcgatcagcggatgtataccttgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system