KEGG   Geobacillus thermocatenulatus: GT3921_06575Help
Entry
GT3921_06575      CDS       T05178                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gtm  Geobacillus thermocatenulatus
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT3921_06575
Enzymes [BR:gtm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GT3921_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO NAD_binding_7 FAD_binding_3 AlaDh_PNT_C Thioredoxin_4 Thi4 Glutaredoxin NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ASS98735
UniProt: A0A226QCU7
LinkDB All DBs
Position
1330578..1332107
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLSCHNCPDVVQALNIMSVLNPNISHTMIDGAAFKEEVEQKGIMAVPTVFLNGKLF
ASGRMSIEDILAKLGSEPDASDFANKEPFDVLVVGGGPAGAAAAIYAARKGIRTGIVAER
FGGQILDTLAIENFISVKYTEGPKLAASLEEHVKQYDVDVMSSQRAKRLEKKDLIEVELE
NGAVLKSKTVIIATGARWRNLGVPGEDEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGMDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATSLEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggatgctgacatcaaggcgcaactagctcagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgccgaaaatcaaagtggaaaaagcgaagctggaacga
acaccaagcttcagcgtcaatcgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcggacggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcaggggcaaacatcatttt
gaaacgtacgtcagcttgagttgccacaactgcccggacgtcgtgcaagcgctcaacatc
atgagcgtcttaaacccgaacatttcgcatacgatgatcgacggagcggcgtttaaggaa
gaagtcgagcaaaaagggatcatggccgtgccgacggtctttttaaatggcaaactgttc
gcgagcggccgcatgtcgattgaagatattcttgccaaattaggaagcgaaccagatgct
tccgattttgccaataaggagccgtttgatgtactcgttgtcggcggtggaccggctgga
gcggcagcggcgatttatgcagcgcgcaaaggcatccgcaccggcattgtcgcggagcgt
ttcggcgggcaaattttggacacgctcgctatcgagaactttattagcgtcaaatatacg
gaagggccgaaactggcggccagcctagaagagcatgtaaagcagtacgacgtcgacgtc
atgagttcacagcgcgcaaaacggctcgagaaaaaagacttgattgaagtcgagctggaa
aatggcgctgtgctgaaaagcaagacggtcattatcgccaccggcgctcgctggcgcaac
ctcggtgtgccgggcgaggacgagttcaaaaacaaaggcgtcgcctactgcccgcactgc
gacggcccgctgtttgaaggcaagcatgtggcggtcatcggcggcggcaactccggcgtc
gaagcggcgatcgacctcgccggcattgccagccatgtgacgctgctggagttcgcccct
gaactcaaggcggatgctgttttgcaagatcgtttgtacagcctgccgaacgtaacggtg
ataaaaaacgcgcaaacgacggaaatcaccggcatggacaaagtcaacggcttgacgtac
attgaccgggaaacaggagaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgtgccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
atcatcgtcgacaaacgcggcgcgacgagccttgaaggtgtctttgccgccggcgactgc
acggacagcgcctataagcaaatcattatctcgatgggctcgggtgcaaccgcggcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system