KEGG   Geobacillus thermocatenulatus: GT3921_13640Help
Entry
GT3921_13640      CDS       T05178                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gtm  Geobacillus thermocatenulatus
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gtm01001]
    GT3921_13640
Enzymes [BR:gtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GT3921_13640
Protein kinases [BR:gtm01001]
 Serine/threonine kinases: Other
  Bacterial family
   GT3921_13640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Seadorna_VP7 RIO1 FTA2 Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-ProteinID: AST00950
UniProt: A0A226Q4W2
LinkDB All DBs
Position
complement(2784137..2786107)
Genome map
AA seq 656 aa AA seqDB search
MLIGKRLNDRYKIISLIGGGGMANVYLARDMILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGATLKQYIQQHAPLPVERALRIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEHGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPSPKAWNPDIPQS
VENIILKATAKDPFYRYQSAREMNEDIRTALDPRRRNEPKFTIPDDDEEATKAVPIIRNA
ESAALEQETLVYEEQTSEPAHAAGEPKPKRKRAWIAWLVAALLFIGAVGVSAVTWIPDLI
FPKEVTMPNVVNKNYDDAVEQLSSLGLEIKDTIDVEDDQVEEGKVVRTDPEAGMTVKKGA
GVIIYKSIGKKKIEFPSFIGDDIAAAEEELRAEGFARITRSGRYSDKPEGTILDQYPYAG
DEVVPDETEVMFTVSLGPEKVTVKDLTGYTEKSVRDYGADQGLRIDVKYEYSDEVPEGLV
ISQTPAANEQVKKGETITVVISRGPEPKPSKTVVKEITIPYEPEMPGQMVEAQLYIQDAT
HNMSTPYKTYRLTAPATEMVEFEIPYGETAYYRVIVNNVVKEEGSIPYPKHNGKKG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgctcattggaaagcgattgaatgaccgctataaaatcatcagcctcatcggcggcggc
ggcatggccaacgtgtatttggcccgcgatatgattttggagcgcgatgttgcagtcaaa
gtgctccgccttgattttgccaatgatgatcagttcatcaaacggttccgccgcgaggcg
caagcggcgacgagcttaaaccatgaacatatcgtctccatttatgacgtcggcgaagaa
gaaggcgtctattacatcgttatggaatatgtgcgcggcgcgacgctgaagcaatacatc
cagcagcacgctccgcttccggtcgaacgggcgcttcgcatcatggatcagttgacgtca
gccatcgcccatgcccatgagaacggcatcatccatcgcgacattaaaccgcaaaacatt
ttgcttgatgagcacggcaatgtgaaagtgaccgacttcggcatcgctgtggcgatgagc
ggcacgacgatcacgcagaccaactcggtgctcggttcggttcattatttgtcgccggag
caggcgcgcgggggcattgcgacagaaaagtcagatatttattcgctcggcattgtcatg
tttgaactcgttaccggtcggctgccgttttccggcgaatcagccgtttcgatcgtgttg
aagcacttgcaggcggaaacgccgtcgccgaaggcgtggaatccggacatcccgcaaagt
gtggaaaacattattttaaaagcgacggcgaaagacccgttttaccgctaccaatccgcg
cgcgaaatgaacgaggacattcggacagcgctggatccaaggcggcgcaacgagccgaaa
tttaccatacccgatgacgatgaggaagcgacgaaagccgttcccattataaggaatgcg
gaaagcgcggcgctggagcaagagacgcttgtgtacgaggaacaaacgagcgaaccggct
catgcggccggcgagccgaaaccaaagcggaaacgggcatggattgcctggcttgtggct
gccttgctgttcattggagctgtcggcgtcagcgccgtcacatggattccggatctcatt
tttccaaaagaagtgacgatgccgaacgtggtcaacaaaaactatgatgacgctgttgaa
cagctgtcgtcgctcggtttggaaatcaaagatacgattgatgtggaagatgatcaagtc
gaagaaggaaaagtcgtgcgcaccgatccggaagccggcatgacggtgaagaaaggggcc
ggcgtcatcatttataaaagcattggaaaaaagaaaatcgaatttccaagcttcattggc
gatgatattgctgcggcggaggaggagctgcgcgccgaaggatttgcccgcatcacacgc
agcggccgctacagcgacaagccggaagggacaattttggatcaatacccgtacgccggt
gatgaagtcgtgcctgatgaaacggaagtgatgttcaccgtcagcctcgggccggagaag
gtcaccgttaaagatttgactggctatacggaaaaaagtgtgcgcgattacggggccgat
caagggttgcgcattgacgtgaagtacgagtattcggacgaggtgccagaagggcttgtc
atttcacaaaccccggcggcgaacgagcaggtaaaaaaaggggaaacgattacggtcgtc
atctcccgcgggccggaaccgaagccgtcgaaaacggtggttaaagagattacgattccg
tatgaaccggagatgccggggcaaatggttgaagcccagctttacatccaagatgccacc
cacaatatgtcaacgccatacaaaacataccggctgacggcgccagcgaccgagatggtc
gagtttgaaattccatatggggagaccgcttattaccgcgtcattgtcaacaatgtcgtc
aaagaggaaggatcgatcccgtacccaaaacataacggaaaaaaggggtga

DBGET integrated database retrieval system