KEGG   Geobacillus thermocatenulatus: GT3921_14190Help
Entry
GT3921_14190      CDS       T05178                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00010  Glycolysis / Gluconeogenesis
gtm00020  Citrate cycle (TCA cycle)
gtm00620  Pyruvate metabolism
gtm01100  Metabolic pathways
gtm01110  Biosynthesis of secondary metabolites
gtm01120  Microbial metabolism in diverse environments
gtm01130  Biosynthesis of antibiotics
gtm01200  Carbon metabolism
Module
gtm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3921_14190
   00020 Citrate cycle (TCA cycle)
    GT3921_14190
   00620 Pyruvate metabolism
    GT3921_14190
Enzymes [BR:gtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GT3921_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AST00085
UniProt: A0A226Q2D2
LinkDB All DBs
Position
complement(2894278..2895582)
Genome map
AA seq 434 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VPEGTVATVGQTLITLDAPGYENMTFKGQEHEEVKKEEKAETVSKKEMVETAASSAPAAE
AGADPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRILKEDIDAFLAGGAKAAAEPTPQ
AAEEKAAPQAPAAKPVVPEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTK
LVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDATEEIIHKHYYNIGI
AADTDRGLLVPVIKHADRKPIFALAKEINELAEKAREGKLMPNEMKGASCTITNIGSAGG
QWFTPVINHPEVAILGIGRIAEKPVVRDGEIVAAPVLALSLSFDHRMIDGATAQKALNHI
KQLLSDPELLLMEA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgccggacattggcgaaggcattcatgaaggcgagatcgtc
aaatggttcgtcaagccgggcgatgaagtgaacgaagacgacgtgttgtgcgaagtgcaa
aacgacaaagcggtcgtcgagatcccatctcctgtcaaggggaaagtgcttgagattctc
gtcccggaaggaacggtggcgacggttgggcaaacgctcattacgctcgatgcgccgggc
tatgaaaacatgacgtttaaaggacaagaacacgaagaagtgaaaaaagaggaaaaagcg
gaaacggtgtcgaaaaaggaaatggttgagaccgctgcttcgagcgcaccggcggccgaa
gcgggagccgacccgaaccgccgcgttatcgcgatgccgtctgtgcgcaaatatgcgcgt
gaaaaaggcgtcgatatccgtctcgtccaaggcacggggaaaaacggccgcattttgaaa
gaagatattgatgccttcctcgccggcggcgcgaaagccgcggctgagccgacgccgcaa
gcggcggaagagaaggcagcgccgcaagcgccagcagcgaaaccggttgtgccggaaggc
gaattcccggaaacgcgcgagaaaatgagcggcatccgtcgggcgatcgccaaggccatg
gtgcattcgaaacatacggccccgcacgtgacgctgatggacgaagccgatgtgacgaag
cttgttgctcaccgaaaaaaattcaaggccattgccgcggaaaaaggcatcaagctgacg
ttcttgccgtatgtcgtcaaagcgcttgtttctgcgctgcgtgaatatccggtgctgaat
acgtcgatcgacgatgcgacggaggaaattattcataagcattactacaacatcggcatt
gccgctgatacggaccgcggcttgctcgtgccggtcattaaacatgccgaccggaagccg
attttcgcgctggcgaaggaaatcaacgaactcgctgaaaaagcgcgcgaaggcaaactg
atgccaaacgaaatgaaaggcgcatcgtgcacgattacaaacatcggctcagccggcggg
caatggtttacgccggtcatcaaccatccggaagtggcgattcttggcatcggccgcatt
gccgaaaaaccggttgtccgcgacggtgaaattgtcgctgctccggtcttggcgctctcg
ctcagctttgaccatcggatgatcgacggagcgacagcgcaaaaagcgctcaaccatatc
aagcagctgttaagcgatccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system