KEGG   Geobacillus thermocatenulatus: GT3921_15245Help
Entry
GT3921_15245      CDS       T05178                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00061  Fatty acid biosynthesis
gtm00780  Biotin metabolism
gtm01100  Metabolic pathways
gtm01130  Biosynthesis of antibiotics
gtm01212  Fatty acid metabolism
Module
gtm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GT3921_15245
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GT3921_15245
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GT3921_15245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gtm01004]
    GT3921_15245
Enzymes [BR:gtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GT3921_15245
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GT3921_15245
Lipid biosynthesis proteins [BR:gtm01004]
 Fatty acid synthase
  Component type
   GT3921_15245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AST00260
UniProt: A0A226Q400
LinkDB All DBs
Position
complement(3113757..3114533)
Genome map
AA seq 258 aa AA seqDB search
MALSLEGRTYVVMGVANKRSIAWGIARSLHAAGARLVFTYAGERFEKEVRALVDTLGDER
SLLLPCDVAKDEHIVQCFAQIKEQVGVIHGVAHCIAYANKEDLSGEYMNVSREGFLLAHN
ISAYSLTAVAREAKELMTEGGSIVTLTYLGGERVVQNYNIMGVAKASLDASVKYLANDLG
KYGIRVNAISAGPIRTLSAKGVSDFNSILKQIEERAPLRRTTTQEEVGDAALFLFSDLSR
GITGEIIHVDSGYHILGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccttatcgttggaaggacgtacatatgtcgtgatgggggtggcgaacaaacgaagc
atcgcctggggcattgctcgttcgcttcacgctgccggcgctcggttggtgtttacgtat
gccggagagcggtttgaaaaagaggtgcgggcgcttgtggatacgcttggggacgaacgt
tcgcttctgctgccatgcgatgtggcaaaagacgaacacatcgttcaatgtttcgcgcaa
atcaaagaacaagtcggcgtcatccatggcgtcgctcattgcatcgcctatgccaataaa
gaagacttgagcggtgagtatatgaacgtaagccgcgaaggctttttgctcgcccacaac
atcagcgcctactcgctcaccgcggtcgcgcgcgaggcgaaagagctgatgacggaaggc
ggcagcatcgtcaccctcacgtacttaggcggcgagcgcgtcgtgcaaaactacaacatt
atgggtgtggcgaaagcgtcgcttgatgcgagcgtgaaatatttggcgaacgatttaggc
aaatacggcatccgcgtcaatgccatttccgctggaccgattcgcacactgtcggccaaa
ggggtgagcgatttcaactcgattttaaagcaaatcgaagaacgcgctccgctccgccgg
acgacgacccaagaagaagtcggtgatgcggcgctgtttttgttcagcgacttgtcgcgc
ggcatcaccggggaaattattcacgtcgactcaggataccacattttaggatattaa

DBGET integrated database retrieval system