KEGG   Geobacillus thermodenitrificans: GTNG_0104Help
Entry
GTNG_0104         CDS       T00496                                 

Definition
(GenBank) EF-Tu
  KO
K02358  elongation factor Tu
Organism
gtn  Geobacillus thermodenitrificans
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gtn03012]
    GTNG_0104
   03029 Mitochondrial biogenesis [BR:gtn03029]
    GTNG_0104
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gtn04147]
    GTNG_0104
Translation factors [BR:gtn03012]
 Eukaryotic Type
  Elongation factors
   GTNG_0104
 Prokaryotic Type
   GTNG_0104
Mitochondrial biogenesis [BR:gtn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GTNG_0104
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GTNG_0104
  Exosomal proteins of breast cancer cells
   GTNG_0104
  Exosomal proteins of colorectal cancer cells
   GTNG_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABO65491
UniProt: A4IJI7
LinkDB All DBs
Position
123852..125039
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEARAYDQIDAAPEERERG
ITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDAQWEEKIVELMNAVDEYIPTPQREVDKPFMMPVEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKSTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgtacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccatgggaaaacgacgttgacagctgcgatcacgacagttcttgcgaaacaaggt
aaagcagaagcgagagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcgga
atcacgatttcgacggctcacgttgagtatgaaacagaaaaccgtcactatgcgcacgtt
gactgcccgggccacgctgactacgtgaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtatcggctgctgacggtccgatgccgcaaactcgcgaacacatt
cttctttcccgccaagtcggtgttccgtacatcgttgttttcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaactcgttgaaatggaagttcgcgatcttctttctgaa
tatgacttcccgggcgacgaagtgccggttatcaaaggttcggcattaaaagcgctcgaa
ggcgatgcacaatgggaagaaaaaatcgttgaactgatgaacgcggttgacgagtacatc
ccaactccgcaacgtgaagtagacaaaccgttcatgatgccggttgaggacgtcttctcg
atcacgggtcgtggtacggttgcaacgggccgtgttgagcgcggtacgttaaaagttggt
gacccggttgaaatcatcggtctttcggacgagccgaaatcgacgactgttacgggtgta
gaaatgttccgtaagcttctcgaccaagcagaagctggtgacaacatcggtgcgcttctc
cgcggtgtatcgcgtgacgaagttgagcgcggtcaagtattggcgaaaccgggctcgatc
acgccacacacgaaatttaaagcacaagtttacgttctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacaacggacgtaacg
ggcatcatcacgcttccagaaggcgttgaaatggttatgcctggcgacaacgttgaaatg
acggttgaactgatcgctccgatcgcgatcgaagaaggtacgaaattctcgatccgtgaa
ggcggccgcacggttggtgctggttccgtatcggaaatcattgagtaa

DBGET integrated database retrieval system