KEGG   Geobacillus thermodenitrificans: GTNG_0205Help
Entry
GTNG_0205         CDS       T00496                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00473  D-Alanine metabolism
gtn01100  Metabolic pathways
gtn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GTNG_0205
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GTNG_0205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gtn01011]
    GTNG_0205
Enzymes [BR:gtn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GTNG_0205
Peptidoglycan biosynthesis and degradation proteins [BR:gtn01011]
 Precursor biosynthesis
  Racemase
   GTNG_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABO65589
UniProt: A4IJT5
LinkDB All DBs
Position
219008..220162
Genome map
AA seq 384 aa AA seqDB search
MDNFHRDTWAEIDLDAIYDNVANLRRFLPDGTQVMAVVKANAYGHGDAQVATTALEAGAS
YLAVAILDEALALRQKGINAPILVLGASRPADVELAARHRITLTVFRADWLEEAASIYNG
STPVHLHLKMDTGMGRLGVKDEEETKRITTLIDRHPSFILEGVYTHFATADEVNTDYLSY
QYRRFLHMLEWLPSRPPIVHCANSATVLRFPERAFNMARFGISMYGLAPSPSIKPLLPYE
LKEAFSLHSRLVHVKRLQPGEKVSYGATYTAQEEEWIGTLPIGYADGWLRRLQHFHVLVN
GQKAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEFISVDDVARYLETINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVCHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacaactttcaccgcgatacgtgggcagaaatcgacttggatgctatttacgacaac
gtcgcgaatttgcgacgctttttaccggatggaacacaggttatggccgttgtaaaagcg
aacgcctacgggcatggtgacgcccaagtggcgacaacggcgctagaagccggtgcttcc
tacttagccgtcgccattttggacgaggcgctcgctttaagacaaaaaggcatcaatgcg
cccattttagtgcttggggcgtcccgcccggccgatgtggagctagccgctcgacatcgc
attactttaaccgtgtttcgcgccgattggttagaggaggcggcatcgatttataacggc
tcgactcccgttcatctgcatttaaaaatggatactggaatgggacggctcggggtaaaa
gacgaggaggagacgaagcgtattacgacgctgattgaccgccacccatcctttatcctt
gaaggggtatatacgcattttgcgacggctgatgaagtgaatacagactatctttcttat
caatatcgccgctttttgcatatgctcgaatggctgccatcgcggccgccgatcgttcat
tgtgccaacagtgcgacggtactccgctttcccgagcgagcgttcaatatggcccgcttc
ggcatttccatgtacggactcgctccatcgccaagcatcaagccgttgcttccatacgaa
ctaaaggaggcgttttcgcttcatagccgcctcgtgcatgtgaaaagattgcaaccgggt
gaaaaggtgagttacggagcgacgtataccgcacaagaggaagagtggatcggtacgctc
ccgatcggctatgcggacggatggctccgtcgcctgcaacattttcatgtgctcgtgaac
gggcaaaaggcgccaattgtcggccggatttgcatggatcaatgcatgattcgcctgcct
gaaccgttgccagtcggtacgaaggtaacattgatcggtcgccaaggagatgagttcatt
tctgttgatgatgtcgcccgctatttggaaacgattaattacgaagtgccttgtacaatc
agttatcgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaatgct
gtttgccacgggtga

DBGET integrated database retrieval system