KEGG   Geobacillus thermodenitrificans: GTNG_0714Help
Entry
GTNG_0714         CDS       T00496                                 

Gene name
fabL
Definition
(GenBank) Enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00061  Fatty acid biosynthesis
gtn00780  Biotin metabolism
gtn01100  Metabolic pathways
gtn01130  Biosynthesis of antibiotics
gtn01212  Fatty acid metabolism
Module
gtn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GTNG_0714 (fabL)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GTNG_0714 (fabL)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GTNG_0714 (fabL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gtn01004]
    GTNG_0714 (fabL)
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GTNG_0714 (fabL)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GTNG_0714 (fabL)
Lipid biosynthesis proteins [BR:gtn01004]
 Fatty acid synthase
  Component type
   GTNG_0714 (fabL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABO66094
UniProt: A4IL90
LinkDB All DBs
Position
792155..792931
Genome map
AA seq 258 aa AA seqDB search
MTLSLEGRTYVVMGVANKRSIAWGIARSLHAAGARLVFTYAGERFEKEVRALVDTLEDER
SLLLPCDVANDEDIVQCFAQIKEQVGVIHGVAHCIAYANKDDLSGEYMKVSRDGFLLAHN
ISAYSLTAVAREAKELMTEGGSIVTLTYLGGERVVQNYNIMGVAKASLDASVKYLANDLG
KYGIRVNAISAGPIRTLSAKGVSDFNSILKEIEERAPLRRTTTQEEVGDAALFLFSDLSR
GITGEIIHVDSGYHILGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcattggaaggacgtacatatgtcgtcatgggggtggcgaacaagcggagc
atcgcctggggaatcgcccgttcgctccacgctgccggtgcccgactcgtatttacatac
gccggagagcggtttgaaaaggaagtacgggcgcttgtcgatacgttggaagatgaacgt
tcgcttctgttgccgtgcgatgtggcaaatgacgaggacatcgttcaatgttttgcgcaa
attaaagaacaagtcggcgttattcatggtgtcgcccactgcatcgcctatgccaataag
gatgatttaagcggcgagtacatgaaggtgagccgcgacggctttttgcttgctcataat
attagcgcctattccctcactgcggtggcacgcgaggcgaaagagctcatgaccgaaggc
ggcagcatcgtcactctcacgtacttaggcggtgagcgcgttgtgcaaaactacaatatc
atgggagtggcgaaagcgtcgttggatgcgagtgtcaaatacttggcaaacgatctaggc
aaatacggcatccgcgtcaacgccatttccgcaggccctattcgcacgctgtcggccaaa
ggagtgagcgatttcaactcgattttaaaagagatcgaggagcgcgcaccgctccgtcgg
acgacgacgcaagaggaagtcggtgatgcagcactgtttttgttcagcgatttatcgcgt
ggcatcaccggggaaatcattcatgtcgactctggataccatattttaggatactaa

DBGET integrated database retrieval system