KEGG   Geobacillus thermodenitrificans: GTNG_1809Help
Entry
GTNG_1809         CDS       T00496                                 

Gene name
iolE
Definition
(GenBank) Myo-inositol catabolism protein IolE
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00562  Inositol phosphate metabolism
gtn01100  Metabolic pathways
gtn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GTNG_1809 (iolE)
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     GTNG_1809 (iolE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: ABO67169
UniProt: A4IPB5
LinkDB All DBs
Position
complement(1919005..1919901)
Genome map
AA seq 298 aa AA seqDB search
MFKENKVKLGIAPIGWTNDDMPELGGEITFEQCISEMALAGFVGCEVGNKYPRDTKILKK
ALSLRGLSIASAWFSAFLTSKPFEETAEAFKAHRDFLYEMGAKVIVVSEQGNSIQGQMET
PLFDKKPVFTEEEWDLLIDGLNRLGDLAAEKGMNIVYHHHMGTGIQTTEEIDRLMEETDP
KKVSLLYDTGHLVFSGEDHLHVLNKHINRIRHVHLKDVRIEVANKVREEKMSFLQAVKAG
VFTVPGDGVIDFKPVFEALDAAGYEGWFVVEAEQDPAIANPFEYALKARQYIRETCGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagaaaacaaagtgaagcttggtattgctccaattgggtggacgaatgatgat
atgcctgagctggggggtgagattacatttgagcagtgtattagtgaaatggcgctcgcc
ggttttgttggttgtgaagtcggcaataaatatccccgtgatacaaagattttgaaaaag
gccttatccttacggggcttaagtatcgccagtgcttggtttagcgcttttttgacctca
aaaccatttgaggaaacagcggaagcatttaaagcacaccgagattttttatatgaaatg
ggcgcaaaagtcattgttgtttctgaacaaggtaacagcatccaaggacaaatggaaaca
ccattgtttgataaaaagccagtttttacggaagaggaatgggatctactgatcgatggg
ttaaatcgcctcggtgatctggctgcagaaaagggaatgaacattgtctatcaccatcat
atggggacgggtattcagaccacagaggagattgaccgcttaatggaggaaacagaccca
aaaaaggtgtcacttctttatgatacaggccaccttgtcttctcaggggaggatcattta
catgtcctaaataagcatataaatcgtattcgtcatgttcatctcaaggatgtacgaatc
gaggtcgcgaataaggttcgcgaggaaaaaatgagcttcttgcaggcggtgaaagctgga
gtatttactgtgcctggcgatggtgtgattgattttaaaccagtattcgaagcattagat
gccgccggctatgaaggatggtttgttgtagaggcagaacaggatccagccatagcgaat
ccgtttgaatatgcgttaaaggcacgccaatatattcgtgaaacatgcggtttataa

DBGET integrated database retrieval system