KEGG   Geobacillus thermodenitrificans: GTNG_2505Help
Entry
GTNG_2505         CDS       T00496                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gtn  Geobacillus thermodenitrificans
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GTNG_2505
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GTNG_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_2 NAD_binding_7 DAO FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 Thioredoxin_4 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABO67850
UniProt: A4IR96
LinkDB All DBs
Position
complement(2609162..2610685)
Genome map
AA seq 507 aa AA seqDB search
MLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKATLERT
PSFSVSRVGENTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVSEDVVRRIQQIRGKHHFE
TYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKEEVEQKGIMAVPTVFLNGEMFA
SGRMSLEDILAKLGSEPDAASFADKDPFDVLVIGGGPAGATAAIYAARKGIRTGIVAERF
GGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYDVDIMIQRAKRLEKKDLIEVELENG
AVLKSKTVVISTGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGVEA
AIDLAGIAKHVTVLEFAPELKADAVLQERLYSLPNVTVIKNAQTKEITGTDKVNGLTYID
RETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRIGEIIVDKRGATNVEGVFAAGDCTD
SAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgctgacatcaaggcacaactcgcccagtacttgcaattgcttgaaaatgac
attgtcttgacagtaagcgcgggagacgacaacgtttcccgcgatatgcttgctttaatc
gatgaattaacggcgatgtcgccaaaaatcaaagtggaaaaagcaacgcttgaacgaacg
ccaagcttcagcgtcagccgggtcggcgaaaacaccggcgtcacctttgctggcgttccg
ttaggccatgagtttacgtctttggtgcttgccctgcttcaagtgagcgggcggccgcca
aaagtcagcgaggatgtggtgcgccgcattcaacaaattcggggcaaacatcattttgaa
acgtacgtgagcttaacgtgccataactgcccggatgtcgttcaagcgctcaacatcatg
agcgtgctcaaccctgacatttcgcatacgatgattgatggtgcggcgtttaaggaagaa
gttgaacaaaaaggcattatggcggtgccgaccgtctttttaaacggcgagatgttcgct
agcggccgcatgtcgcttgaagacattctcgcaaaattaggaagcgagccggacgctgct
tcatttgccgataaagacccgtttgatgtgcttgtcatcggcggcggaccagcgggtgcg
acagctgccatttatgcggcgcgcaaaggcatccgcaccggtattgtcgctgagcgcttc
ggcggacaaattttagatacgctcggtattgagaacttcatcagcgtcaaatataccgaa
gggccgaagctggcagccagcattgaggagcatgtcaaacagtacgatgtcgacatcatg
atccagcgtgccaaacggctcgagaagaaagatcttattgaagtcgagctggaaaacggt
gctgtcctgaaaagcaaaacggtggttatttccactggcgcacgttggcgcaatctcggt
gtgccgggtgaggaagagttcaaaaacaaaggggttgcctactgcccgcattgcgacggc
ccgctgtttgaaggcaagcacgtggcggtcattggcggcggtaactccggcgtagaagcg
gcgattgacctcgctggcatcgctaaacatgtgactgtgctcgagttcgctcctgaatta
aaagcggatgctgttttgcaggagcgattgtatagcttgccgaacgtgacggtcattaaa
aatgcgcaaacgaaagaaattaccggtacagacaaagtgaatggccttacgtatatcgat
cgcgaaacaggggaagagcaccatatcgagttgcaaggtgtattcgttcaaatcggactt
gtgccgaatacagagtggctggaaggaacggttgaacggaatcgcatcggcgaaatcatc
gtcgataaacgcggcgcgacaaatgttgaaggcgtctttgccgcgggcgattgcacggac
agcgcttataagcaaatcattatttccatgggttcaggcgctactgccgcattgagtgcg
tttgattacttaattcgccactaa

DBGET integrated database retrieval system