KEGG   Geobacillus thermodenitrificans: GTNG_2513Help
Entry
GTNG_2513         CDS       T00496                                 

Definition
(GenBank) Protein-export membrane protein
  KO
K12257  SecD/SecF fusion protein
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn02024  Quorum sensing
gtn03060  Protein export
gtn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    GTNG_2513
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GTNG_2513
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GTNG_2513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gtn02044]
    GTNG_2513
Secretion system [BR:gtn02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   GTNG_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG MMPL POTRA
Motif
Other DBs
NCBI-ProteinID: ABO67858
UniProt: A4IRA4
LinkDB All DBs
Position
complement(2618674..2620926)
Genome map
AA seq 750 aa AA seqDB search
MVKQSRIVTFFLLVLLLAGVIGPTIQGILHNIKLGLDLQGGFEVLYEVKPAKKGDKIDQE
TLQSTVSALNKRINVLGVSEPRVDIEGENRIRVQLAGVKDQNEAREILATQAKLTFRDVN
DNVLMDGSDLVQGGAKLSFDENGQPSVAIKLKDADKFRQVTEKVYNMGPPNNILVIWLDF
EEGVDSYQKEAGKADPKFISAASVNQVFNQTDVSIVGNFTVKEAQQLADLLNAGALPVEL
HEIYSTSVGAQFGKNALQTTMLAGIIGVAAIFLFMIWFYRLPGVIAVITLSVYIYLILLL
FDWMNGVLTLPGIAALILGVGMAVDANIITYERIKEELKLGKSMMSAFRAGNRGSFATIF
DANITTIIAGVVLFIYGTSSVKGFATMLIISIVASFVTAVYGTRLLLGLLVSSRWLDKKP
GYFGVKKSEILNIAETTDETEVPTKFDRWDFIKHSKKFFLFSIALTIAGVISLFAMGLNL
GIDFTSGTRIEVTSSQPIEAKELSDYFEQLGHKPEDVVLSGTDGKTGVVRLIGVLDKQEI
AKIKSELKTTYGHEPNISTVSPVVGKQLARNALIAVLISSIGIILYVTIRFEWRMALAAI
IALLHDAFFIITVFSLTRLEVDLTFIAAVLTIIGYSINDTIVTFDRIRDLMKKRKVKTVD
DLRHIVNRALQQTFTRSINTVLTVLFTVIALLLFGSEAIRNFNLALLAGLLCGVYSSLFI
AAQLWLVWKGNALKKGKGTKKITPETEPHL
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacaaagtcgcatcgtcacgttttttttgctcgtgctcctattggctggagtg
atcggaccgacgattcaaggaattttacataatatcaagctcggccttgatttgcaaggc
ggttttgaagtgttgtatgaggtgaagccggcgaaaaaaggcgataaaattgaccaggaa
acgctccaaagcacggtcagcgccttaaacaagcggattaacgtcctcggcgtcagcgag
ccgcgcgtcgacatcgaaggcgaaaaccgtattcgcgtccagctcgccggggtgaaggat
caaaacgaggcacgcgaaattttggccacccaggcaaagttgacgttccgtgacgtcaat
gacaacgtgctcatggacgggagcgatcttgtccaaggcggagcgaagctgtcgtttgat
gagaacggtcagccgagtgtcgctattaaattgaaagatgccgataagtttcgccaagtg
acggaaaaagtgtacaacatgggtccaccgaacaatattttggtcatttggcttgatttt
gaagaaggagttgactcgtaccaaaaagaagcgggcaaagcggatccgaaatttatttcc
gctgcttcggtcaaccaagttttcaatcagacagacgtgtcgattgtcggcaactttacg
gtgaaagaagcacagcagctggctgatctgttaaacgccggcgcacttccagtcgaattg
catgaaatttactcgacgtctgttggcgcccaattcgggaaaaacgccctgcaaacaacg
atgttggctggcatcatcggtgttgctgccatcttcttgtttatgatttggttttaccga
ttgccaggcgtgattgccgtcattacactgtcggtgtacatttatttgattctgttattg
tttgattggatgaacggcgtcttgacgttgccaggcattgccgcccttattttaggggtc
gggatggcggtcgacgccaacattattacgtatgagcgaatcaaggaagagctaaagctt
ggcaaatcgatgatgtcggcgtttcgcgccggcaaccgaggttcgtttgcaacgattttt
gacgccaacattacgacgatcatcgccggcgtcgtcctgttcatttacggaacaagctcg
gtcaaagggttcgcgacgatgctcattatcagcattgtcgccagctttgtcactgctgtc
tacggcacgcgcctgttgctcgggctgctcgtctcaagccgctggcttgataagaaaccg
ggttatttcggcgtgaaaaaatcggaaatcttaaacattgccgaaacgaccgatgagaca
gaagtgccgacgaagtttgaccgttgggattttatcaaacatagcaaaaagtttttcctg
ttctccatcgccttgacgattgccggtgtcatttcactttttgccatggggctcaatctc
ggcattgatttcacgagcgggacgcgcattgaggtgacgagcagtcaaccgattgaagcc
aaggagctaagcgactattttgaacagcttggtcacaagccggaggatgtcgttttatct
ggcacggacgggaaaacaggcgtcgtccgcttgatcggagtgcttgacaagcaggaaatt
gcgaaaatcaaaagtgagctgaaaacgacgtacgggcatgaacccaacatcagcaccgtg
tcgcccgttgtcggcaagcagttagcgcgaaacgcgctcattgccgtgctcatttcgtcg
attgggatcattctttatgtgacgatccgctttgaatggcggatggcgttagctgctatc
atcgccttattgcacgatgcgtttttcatcattactgtgttcagcttgacgcggcttgag
gttgatttgacgttcatcgccgccgtgttgacgatcattggttactcgatcaatgatacg
attgtcacgtttgaccgcattcgcgatctcatgaaaaaacggaaagtgaaaacggtcgac
gatttaaggcacatcgtcaaccgagcgttgcagcaaacgttcacacgctcaatcaacacc
gtattgaccgttttgtttacggtgattgccttacttctgtttggcagcgaggcgatccgc
aacttcaaccttgccttgctcgccggcctgttgtgcggcgtctattcctcgctgttcatc
gctgcacagctgtggctcgtttggaaaggaaatgcgctcaaaaaaggcaaagggacgaaa
aaaatcacgccggaaaccgagccgcacctgtaa

DBGET integrated database retrieval system