KEGG   Geobacillus thermodenitrificans: GTNG_2528Help
Entry
GTNG_2528         CDS       T00496                                 

Definition
(GenBank) Extensin protein
Organism
gtn  Geobacillus thermodenitrificans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABO67873
UniProt: A4IRB9
LinkDB All DBs
Position
complement(2632196..2633701)
Genome map
AA seq 501 aa AA seqDB search
MIMPGMKIKVPTAGVPIKKETKTYAPSKKPKVGEHPYAETKPFVSFNIDAEMDTASGSVS
ENEVPVNEAPKAVEKEKPKAPAAKAPKAEVKEKPKAPAVEAPKAEAKEKPKAPAVEAPKA
EAKEKPKAPAVEAPKAEVKEKPKAPAAKAPKAEVKEKPKAPAVEAPKAEGKGTAKAPISG
TSKGMENKKANVSVNEAPNVPVNETPNVPVNEAPNVPVNETPNVPANEAPKAPTAYTPPL
THTIPPVVPTPHVSFAKSLPNLPPIPPKPSNILPGMMKEEMDESPTELKGEQTEIADESE
ETPPPLPNIPHVPIAPMTAPVFGVDQGCVPVTPILPGAGFYMSPPPAMPSYSPPPGSLGG
GPENNPAPFPGISEGSNDSLESPQFSEPGKHGAAAPLAPPAGAAFAASGPAAPGYAPSGV
YAPLAGYPPFGYVPVYPPTPYYGGYAPPGVYAQPAPYGYAPQQAAQAIPWPGAVYPVSPP
AAGSRLFAGPPDEESEHGEEQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcctggcatgaaaattaaagtgccgacagcaggagtgccaataaaaaaagaa
acaaaaacgtatgcaccgtcgaaaaagccgaaagtgggagaacatccgtacgcggagacg
aaaccgttcgtttcattcaatattgatgcggagatggacacagctagcggctccgtctcg
gaaaatgaagtaccagtgaacgaggcgccgaaagcagtggaaaaagaaaaaccgaaggcg
ccagcggccaaagcgccgaaagcggaagtgaaagaaaaaccgaaagcaccagcggtcgaa
gcaccgaaagcggaggcgaaagaaaaaccgaaagcgccagcggtcgaagcaccgaaagcg
gaggcgaaagaaaaaccgaaagcgccagcggtcgaagcaccgaaagcggaggtgaaagaa
aaaccgaaagcaccagcggccaaagcgccgaaagcggaagtgaaagaaaaaccgaaggcg
ccggcggtcgaagcgccaaaggcagaggggaaaggaacagcaaaggcgccgataagcggg
acatcgaagggaatggagaacaagaaggcgaatgtgtcagtgaacgaagccccgaatgtg
ccggtgaacgagacaccgaacgtaccagtgaacgaagcgccgaacgtgccggtgaatgaa
acaccgaacgtaccggcgaacgaggcgccgaaagcaccgacagcctatacaccgccgctt
acacatacgattccgccggtcgttccgacccctcacgtttcgtttgccaaatcgttgccg
aatctgccaccgattccaccgaagccgagcaacattttgcctggcatgatgaaagaggag
atggatgaaagcccaactgaactgaaaggggaacaaacagaaatagcagacgaaagcgag
gaaaccccgccaccgttgccgaacattccgcatgttccaattgcaccgatgacggcacca
gttttcggtgttgaccaaggatgtgtgccagtgacgcctattttgccaggagcggggttt
tacatgtctccgccgccagccatgccatcttattctccgccgccgggttcgttagggggc
ggcccggaaaataacccggctccatttccgggcattagcgaagggagcaatgattcttta
gagtctccgcagttttctgaaccggggaaacacggggctgctgctccgcttgcaccgcca
gctggtgccgctttcgctgcgtccggtcctgccgcaccgggatatgcaccatctggagtg
tacgcgccgctagccggatatccgccttttgggtatgtgcctgtgtatccaccgactccg
tactacgggggatatgcccctccgggagtgtacgcccagccggctccatacgggtacgcg
ccgcaacaagctgcgcaggcgatcccgtggcccggtgccgtttacccggtaagcccaccc
gccgccggttcgcgcctgtttgccggaccgccggatgaggagagcgagcatggggaagaa
cagtaa

DBGET integrated database retrieval system