KEGG   Geobacillus thermodenitrificans: GTNG_2659Help
Entry
GTNG_2659         CDS       T00496                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00020  Citrate cycle (TCA cycle)
gtn00480  Glutathione metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
gtn01210  2-Oxocarboxylic acid metabolism
gtn01230  Biosynthesis of amino acids
Module
gtn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTNG_2659
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GTNG_2659
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GTNG_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABO68004
UniProt: A4IRQ0
LinkDB All DBs
Position
complement(2767366..2768637)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGNWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFQGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKALADAEATGKIIIKDAIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAQLIIQAMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattactgtcaccaatggtgttctcaacgttccaaacaacccg
atcatcccgttcattgaaggggacggaacgggtccggacatttgggcagccgcttcgcgc
gtgctcgaagcagccgttgaaaaagcgtacaaaggcgagaagaaaatcgtctggaaggaa
gtgcttgctggtgaaaaagcgtacaagctgacgggcaactggcttccagatgaaacgctt
gagacgatccgcgaatacataatcgctattaaagggccgttgacgacgccggttggcggt
ggcatccgttcgttgaacgttgcgctccgccaagagctggacttgttcgtctgcctgcgt
ccggttcgttacttccaaggtgttccgtcgccggtaaaacgtccggaagataccgacatg
gtcattttccgcgaaaatacggaagacatttacgccggtattgagtatgcaaaagggacc
ccagaagtgaaaaaagtgattgactttttgcaaaacgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggtatcggcatcaaaccgatttctgaagaaggaacgaaacggctc
gtgcgcgcggcaatcaactatgcgatcgaacacggccgcaagtcggttacgctcgtccat
aaagggaacattatgaagttcactgaaggggcgtttaaaaactggggttatgagctggct
gaacaagagttcggcgacaaagtgttcacgtgggcacaatatgaccggatcgttgaagca
gaaggaaaagaagcggcgaacaaagcgcttgctgacgcggaagcgaccggtaaaatcatc
attaaagacgccatcgccgacatcttcctgcagcaaattttgacgcgtccgcgcgaattt
gatgtcatcgcgacgatgaacttaaatggcgattacatttccgatgcactcgcagcccaa
gtcggcggtatcggcatcgcaccaggagcgaacatcaactatgaaaccggtcacgccatt
ttcgaagcgacgcacggcacggcgccgaaatatgctggtttggacaaagtcaatccgtcg
tcggttattttgtccggcgtcatgatgtttgagcatctcggctggaacgaagcagctcaa
ttgatcattcaagcaatggaaaaaacgatcgcgtccaaagtggtcacgtacgatttcgcc
cgtctgatggaaggggcaaccgaagtgaaatgttcggaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system