KEGG   Geobacillus thermodenitrificans: GTNG_3020Help
Entry
GTNG_3020         CDS       T00496                                 

Definition
(GenBank) Histidine biosynthesis bifunctional protein (phosphoribosyl-AMP cyclohydrolase/phosphorribosyl-ATPpyrophosphohydrolase)
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00340  Histidine metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01230  Biosynthesis of amino acids
Module
gtn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    GTNG_3020
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     GTNG_3020
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     GTNG_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: ABO68365
UniProt: A4ISR1
LinkDB All DBs
Position
complement(3116894..3117541)
Genome map
AA seq 215 aa AA seqDB search
MIADIRFDEKGLVPAIVQDAQSKEVLMLAYMNKESLEKTLETGETWFYSRSRQELWHKGA
TSGNVQRVVDIRYDCDADTLLVLVEPAGPACHTGSYSCFSRSLNGEARTPTADRFTILNE
LEQIIAQRDAERPEGAYTTYLFEKGVDKILKKVGEEAAEVIIAAKNRSHDELKWEAADLL
YHLLVLLREQKLPLDAVLATLVERHAQKTGAVENK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggacattcggtttgacgagaaggggcttgtgcctgccatcgttcaagatgcg
caaagcaaagaagtgctcatgcttgcgtatatgaacaaagaatcgctcgaaaaaacgctc
gagacaggggaaacgtggttttacagccgctctcgtcaagaactttggcataaaggagcg
acgtcaggaaacgtgcagcgtgtcgtggacattcgctacgactgtgacgccgatacgctc
cttgtgcttgttgagccggccggcccggcttgccataccgggtcgtattcctgcttttcc
cgctcgctaaatggcgaggcgcgcacgccaaccgccgatcggttcacgattttgaatgag
cttgaacaaattattgcccagcgcgacgctgaacggccggaaggcgcgtatacgacgtat
ttgtttgaaaaaggcgtcgataaaattttgaaaaaggtcggtgaagaggcggcagaggtg
attatcgccgcgaaaaatcggagccatgatgagttaaaatgggaagcggccgacttgctg
tatcatttgcttgtgctgttgcgtgaacaaaaactgccgcttgacgcggtgctggcaacg
cttgtcgagcggcatgcgcaaaaaacaggagcagtcgaaaataaataa

DBGET integrated database retrieval system