KEGG   Geobacillus thermodenitrificans: GTNG_3117Help
Entry
GTNG_3117         CDS       T00496                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00620  Pyruvate metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_3117
   00620 Pyruvate metabolism
    GTNG_3117
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GTNG_3117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABO68462
UniProt: A4IT08
LinkDB All DBs
Position
3216902..3218422
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGKPYCEVPRSKAADIEL
ALDAAHAAKDEWGRTSPAKRARLLNKIADRMEENLELLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFFDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDEDEAL
AIANETLYGLGAGVWTRNINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNMLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgcacaaccaggccagccaggagcgcttgtcacgttcaaaaagcgctacgaa
aactttattggcggaaaatgggtgccgccggtcgatggcgaatatttcgaaaacattacg
ccgatcaccggaaagccgtattgcgaagtgccgcgctcaaaagcggcagacatcgaactg
gcgcttgacgctgcccacgcggcgaaagacgagtggggacgcacctctccggccaaacgc
gcccgcctgttgaacaaaatcgccgaccgcatggaagaaaacttggagctgctcgccgtc
gcagaaacgtgggaaaacggcaaaccgattcgcgaaacattggcagctgacattccactt
gccattgaccatttccgctatttcgccagctgcatccgcgcccaagaaggcacgatctcg
gagatcgaccatgatacggtcgcctatcacttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattttaatggcagcctggaaactcgctccggcgctcgca
gccggcaactgcgtcgtcctgaaaccggcggagcaaacgccgacgtcgatcctcgtcctc
atcgaactcatcgaagatttgcttccacctggtgtcgtcaacattgtcaacggatttggc
ttagaagccggcaaaccgctcgcctcaaacccgcgcgtcgcgaaagtggcgttcaccggc
gaaacgacaaccggacggctcatcatgcaatacgcgtcgcaaaacatcgtgccggtcacc
ttagaacttggcggcaaatccccgaacattttcttcgctgacgtgatggacaaagatgac
gaatttttcgataaagcgctcgaagggtttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcattcacgagtcgatttacgacgccttcatggaacgg
gcgcttgagcgcgtcaaacaaattaagcagggcaatccgctcgacacggaaacgatgatc
ggcgcgcaagcttcgtctgagcagctcgaaaaaatcttgtcgtacatcgacatcggcaag
caggaaggggccgagcttctcatcggcggcgagcggaacatgcttgaaggggaactggcc
ggcggctattacgtcaagccgaccattttcaaagggcataacaaaatgcgcattttccaa
gaagaaattttcgggccggtgcttgccgtcacgacgtttaaagacgaagacgaagcgctc
gccatcgccaacgaaacgttgtacggcctcggcgccggcgtctggacgcgcaacatcaac
accgcctaccgattcggccgcggcatccaggccggccgcgtttggacgaactgctaccac
gtctacccagcccacgccgcgtttggcggctacaaaatgtccggcatcggccgcgaaaca
cacaaaatgatgctcgaccattaccaacaaacgaaaaatatgcttgtcagctattcgccg
aaaaaactcggcttgttctaa

DBGET integrated database retrieval system