KEGG   Geobacillus thermodenitrificans: GTNG_3245Help
Entry
GTNG_3245         CDS       T00496                                 

Definition
(GenBank) Acetyltransferase GNAT family
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00220  Arginine biosynthesis
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01130  Biosynthesis of antibiotics
gtn01210  2-Oxocarboxylic acid metabolism
gtn01230  Biosynthesis of amino acids
Module
gtn_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    GTNG_3245
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     GTNG_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_4 Acetyltransf_CG Acetyltransf_9 PanZ
Motif
Other DBs
NCBI-ProteinID: ABO68586
UniProt: A4ITD2
LinkDB All DBs
Position
3359845..3360297
Genome map
AA seq 150 aa AA seqDB search
MQIDHAVTSDVKEIHALIQHFAEKGLVLPRSLLSIYQHLQCMYVARENNQIVGVGGLHIL
GHDLGEVRSLVVSSDHMGKGIGRLLVEHIANEAARLGVKRLISFTYQVEFFRKCGFEIVD
KSTLPEKVWIDCVNCPKLDCCDETAMIKYI
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgaccatgccgtcaccagtgatgtgaaagaaatacatgcgttaattcaacac
tttgcggaaaagggattggttttgccgcgttcgttattatccatctatcagcacttgcaa
tgcatgtacgtagcaagggaaaacaaccaaatcgttggagtaggaggattacatatctta
gggcacgatctgggggaagttcgttcgttagtcgtatcctccgatcatatggggaaagga
atcggccgcctgctcgttgaacatattgcgaacgaagcggccagactcggggtgaagcgg
ttaatctccttcacgtaccaagtggagttttttcgaaaatgcgggtttgagatcgtagat
aaatcaacactgccggaaaaagtgtggattgactgtgtcaattgcccgaaactcgactgt
tgcgatgaaacagccatgatcaaatacatttga

DBGET integrated database retrieval system