KEGG   Gloeophyllum trabeum: GLOTRDRAFT_108356Help
Entry
GLOTRDRAFT_108356 CDS       T03130                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
gtr  Gloeophyllum trabeum
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gtr03036]
    GLOTRDRAFT_108356
Enzymes [BR:gtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GLOTRDRAFT_108356
Chromosome and associated proteins [BR:gtr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     GLOTRDRAFT_108356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 19298905
NCBI-ProteinID: XP_007870532
JGI: Glotr1_1_108356
UniProt: S7PTK3
LinkDB All DBs
Position
Unknown
AA seq 646 aa AA seqDB search
MKQDNGGGDALPLPLGQVHSATNKLGIFLQDACLNHRYIRNRDTSNIVERPERIKAVKVG
ISAALARLEDLAEPPKDPDKLKSQGASEPDDLAAAMGRMAIQSREEYAVGAGLPLEIKKS
AASVDLLDDKAVKFVHGDIEGDVYLENLKHWAKESEERISKGESEIPEGLPQGDLYRASF
ASSIVGTEYVIFSLHASVCPSSMDAIQGALGTVCEAVGTVVKASRSEPADRKAASSSPSD
LLQASRAFVAIRPPGHHCGEDSPSGFCFVNNVVVGAAHAHLRHGINRVIILDIDLHHGNG
TQSLIWQINEESYRRKLESKYSGETKPELQVYYGSVHDILSYPCEDGKPELVQAASVSIH
GPHGQYIENVHLVPYDSPEQFWNVVYKGPYSRLLDKAEEFLGQTGGPGDDVLVFISCGFD
ACEHEYPSMSRHQRKVPASFYHRFARDAAALADRYARGRLVSVLEGGYSDRALTSGAMAH
ICGLVDLGEKTECVKEVWWDLDNLVKATKKGKRGRQSLPGTSEPWVQRTLEILSVLDEGC
QYSLPSSRVPPSTRTLRGRKKDQNYAQLDAGTTPPASPPKRRGGRKSNDVTEVETVVAPS
ATSEDNSGSRTDASVEAKSETEGQGVVQKKLPKVILHVRPLPEAKS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagataatggtggtggggatgcccttcctttgcccctgggacaagttcactcc
gcgaccaacaaactcggcatcttccttcaggacgcttgcctcaatcaccggtacattcgc
aacagagatacttctaacattgtggaacgccctgaacgaatcaaagcggtgaaagtgggt
atctctgctgcactcgcacggctggaggacctcgcggagccacccaaagacccggacaag
ctgaagtcccaaggtgcctcagaaccagatgatttagccgctgcgatgggacgcatggcc
attcaaagccgagaggaatatgcagttggcgcaggtcttcctctcgagataaaaaagagt
gcggctagtgtggatctcctggacgacaaggcggtgaaattcgtgcatggcgatattgag
ggagacgtgtacctagaaaatctaaaacattgggcgaaagagagcgaagaaagaatttca
aaaggagaatcagaaatccccgaaggactgccccaaggcgatttgtaccgtgcgtcgttc
gcatctagcattgtaggaaccgaatatgtgatattctcccttcatgcctcagtgtgccct
agctctatggacgccatccaaggcgctttggggactgtttgtgaagctgttggcaccgtt
gtgaaagctagtcgctcggaaccggcggatagaaaggccgcaagcagttccccttcggac
cttctacaggcgtccagggcatttgtggcaataaggcctcccggacatcactgcggagaa
gacagcccctctggtttctgcttcgtcaataacgtcgtagtcggggctgctcatgcccat
ctccgacatggaatcaatagggtgatcatcctagacattgatctgcaccatgggaacggg
acgcagtccttgatctggcagatcaacgaagaatcctaccgacggaaactcgagtccaaa
tattcaggcgagaccaaacctgaactgcaagtatattacggctctgtgcacgacatactc
tcatatccctgtgaggacggcaaaccggaattagtgcaggcggcttccgtatcaatacac
ggaccccacgggcagtatatcgagaatgtccacttagtgccgtacgactcgcccgagcag
ttctggaatgtggtgtacaaaggtccgtatagcagacttctagacaaggccgaggaattc
ctcgggcagaccggtggcccgggagacgatgtccttgttttcatcagctgcggcttcgac
gcgtgcgagcacgagtacccttccatgtcccgccaccagcgcaaggtcccggcatccttc
taccatcggttcgctcgggacgccgccgcactggcggacagatacgcacgcggccggttg
gtcagcgtgcttgaaggcgggtatagcgaccgcgcgctcacgagcggggcgatggcgcat
atctgtggattggttgacctgggtgagaaaacggagtgcgtcaaagaagtctggtgggat
cttgataacctcgtgaaggcaacaaagaagggcaagcgagggaggcagtccctccctggc
acatccgagccatgggtgcagagaacacttgaaattctctcagtcctcgacgagggctgc
cagtacagcctcccctcgtcgcgcgtcccgccctcgaccaggaccctccgtgggcggaag
aaggaccagaactacgctcagctcgatgcaggtacgaccccgccggcctccccccctaaa
cggagaggagggcgaaagagcaatgatgtgaccgaggtggagacggtcgtggcgccgtct
gccacctcggaggataacagtggaagcaggacggatgcctcagttgaagcaaagtcggag
acggaaggtcaaggtgttgtacagaagaaattgccgaaggttattctacacgtccggccc
ctgcccgaggcgaagtcttaa

DBGET integrated database retrieval system