KEGG   Gloeophyllum trabeum: GLOTRDRAFT_110029Help
Entry
GLOTRDRAFT_110029 CDS       T03130                                 

Definition
(RefSeq) glycosyl transferase
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    GLOTRDRAFT_110029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gtr01003]
    GLOTRDRAFT_110029
Enzymes [BR:gtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     GLOTRDRAFT_110029
Glycosyltransferases [BR:gtr01003]
 Glycan extension
  Yeast mannan chain
   GLOTRDRAFT_110029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 19299133
NCBI-ProteinID: XP_007863374
JGI: Glotr1_1_110029
UniProt: S7QG12
LinkDB All DBs
Position
Unknown
AA seq 379 aa AA seqDB search
MMTPMRYVLLVLGIIIGLHFILSVSHEEYGRATSLSNLADQFRAPNPPYKNTVPDEYYAP
SDNTTHPGRRANAVIVMLARNSDLPGVVSSMKQLEDRFNKKFRYPYVFLNEEDFSDEFKD
RILTITDSEVQFGLIPHDHWYQPSWIDEDKASAARADMIKNNVIYGGSVPYRNMCRFNSG
FFYRHELLKNYKYYWRVEPDVKFFCDLDYDPFLIMEDGSKVYGFTVSLYEYEATIPTLWN
AVKEFINANPGLVAEDNAMAFLSDDGGETYNRCHFWSNFEIGDLDLWRSEAYSKFFDFLD
EKGGFYYERWGDAPVHSIGAALFARKDQIHFFNDIGYRHEPFQHCPQGAAHKRGKCWCDP
KQNFDYEWYSCLNRYDKLF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgcctatgcgttacgttctgctggtactgggtatcataattggattacatttt
atccttagcgtctctcatgaagaatatggacgagcgacatcattgtctaaccttgccgac
caattccgtgcacccaatcctccgtataagaacaccgtgccggacgagtactacgcaccc
tccgacaacacgactcacccaggacggagggctaatgcagtgattgtcatgcttgcgcgg
aacagtgatctgcctggcgtagtatctagtatgaagcagttggaagaccgcttcaacaag
aagttccggtatccctacgtcttcttgaacgaagaagacttcagtgacgagttcaaggat
cgcattcttaccatcacggactccgaggtccagtttggtcttataccccacgatcactgg
taccagcccagttggatagacgaggacaaggccagcgcagctagagctgacatgattaag
aataatgtcatatatggaggcagcgtaccataccggaacatgtgccgcttcaactcaggc
ttcttctaccggcacgagctgttgaagaactacaagtattactggagagttgagcccgat
gtcaagttcttctgcgatcttgactatgaccctttcctgatcatggaggacggcagtaaa
gtctacggctttaccgtctccttgtacgagtacgaggctaccatacctacactctggaat
gcggttaaggagttcatcaacgcgaacccgggtttggtggcagaggataatgccatggca
ttcctttcagatgatggtggcgaaacatataaccgctgtcacttctggagcaactttgag
atcggagaccttgacttatggcgaagcgaagcctattccaagtttttcgatttcctggat
gagaagggtggtttctactacgagcgatggggagacgcacctgtccacagcataggagcc
gccctgttcgctcggaaagaccagatccacttcttcaacgacattggttaccggcatgaa
cctttccagcactgccctcaaggcgcggcacacaagcgaggaaagtgctggtgcgacccg
aaacaaaacttcgactatgagtggtactcttgtctgaacagatatgacaagttattctag

DBGET integrated database retrieval system