KEGG   Gloeophyllum trabeum: GLOTRDRAFT_110265Help
Entry
GLOTRDRAFT_110265 CDS       T03130                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00020  Citrate cycle (TCA cycle)
gtr00190  Oxidative phosphorylation
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
gtr01130  Biosynthesis of antibiotics
gtr01200  Carbon metabolism
Module
gtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gtr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLOTRDRAFT_110265
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GLOTRDRAFT_110265
Enzymes [BR:gtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GLOTRDRAFT_110265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19299178
NCBI-ProteinID: XP_007863722
JGI: Glotr1_1_110265
UniProt: S7QFH4
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MLRKTLHRALPRSQRAFSSSAPARKIVATNPVKAEEVKSWSSGQYPLIEHEYDAIVVGAG
GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIHYMCREAPRTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCA
AAADRTGHALLHTLYGQSLRHNTQFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAH
KTVLATGGYGRAYFSCTSAHTCSGDGNAMVTRAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSH
LPPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVDKDGKD
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKAIPEEAG
LESVEFLDKIRKADGPEPTAKIRLDMQKAMQADAAVFRTQETLDEGVEKIRSIYKNFEKV
GIKDRSMIWNSDLVETLELRNLLSNAVQTITAAAARKESRGAHAREDFPERDDEHWMKHT
LTWQHDINSPEVDIKYRGVIDKTLDENECKPVPPFKRVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggaagacattgcacagggcccttcctcgctcgcagagggcattcagcagctca
gcccctgcccggaagatcgtggcaacgaaccccgtcaaggcagaggaggtcaagtcatgg
tcttcgggacagtaccctttgatcgaacacgagtatgatgctattgtcgtgggtgctgga
ggtgctggattacgggcagcgtttgggttggcagaggctggattcaacaccgcgtgtata
acgaagttgtttcctacccggagtcacactgtcgcagctcagggtggtatcaatgctgct
ttagggaacatgaccgaggacgactggagatggcacatgtacgacacggtcaaaggctcg
gactggcttggtgaccaagatgcgattcattacatgtgtcgcgaagctcctcgcactgtc
attgagctcgagcacttcggtgtccccttctcgcgtaccaaggagggcaaaatctaccag
cgtgccttcggtggtcagtcactgaagtacggtaagggtggtcaggcatatcggtgcgcg
gcggcagcagaccgtacgggccatgctcttttacacactctctacggccagtcactgcga
cacaacacccagttcttcattgagtatttcgccctcgacctgatcatgcaagatggtgaa
tgtgttggcgtgatcgctctgaatatggaggacggtactcttcaccgattcagggcccac
aagaccgtcttggctactggagggtatgggcgggcttacttcagttgtacgagtgcgcat
acgtgttccggagacggaaatgcaatggtgacacgagcgggactgcccctccaggacctg
gagtttgtccagttccacccgaccggtatctacggcgctggatgtcttatcaccgaagga
tctcgtggcgagggaggatacctcttgaactccgagggtgagcggttcatggagcgttac
gctccaaccgcgaaggatcttgcttctcgggatgtcgtctcacggagtatgacgattgaa
atccgcgagggtcgtggcgttggcccggagaaggaccacatctacctccaactcagtcac
ttgccccccgaggtcctgcacgagcgcttgcccggtatctccgagacagcggctatcttc
tcaggtgtcgatgtcacgaaggagcctattcccgtcttgcccacggtgcactacaacatg
ggtggtatccccactaagtacaccggtgaggtgctcacggtcgacaaggacggtaaggac
aaggtcgtccccggtctgtacgccgctggtgaggctgcctgtgtctccgtgcacggtgcg
aaccgtcttggtgccaactccctcctggatatcgtcgtcttcggccgtgcctgcgctcac
cacatcaaggagacccttacgcctggaaagccccacaaggcgatccctgaggaggctggt
ctggaaagcgtggaattcttggataagatcaggaaggcggacggccctgagcctacggct
aagatccgtctcgacatgcagaaggccatgcaggctgatgctgcagtcttcaggacgcag
gagactctggacgagggtgtagagaagatccgctctatctacaagaacttcgagaaggtc
ggcatcaaggataggagcatgatctggaactctgacttggttgagacgcttgagcttcgc
aacctgttgagcaacgcggtgcagaccatcactgccgccgccgctcgcaaggagtcgcgt
ggcgcgcacgctcgtgaggacttccctgagcgtgatgacgagcactggatgaagcataca
ctcacttggcaacacgatatcaactcgcctgaggtggacatcaagtaccgcggtgtgatt
gacaagactctcgacgaaaacgagtgcaagcccgtgccgccgttcaagcgtgtgtactag

DBGET integrated database retrieval system