KEGG   Gloeophyllum trabeum: GLOTRDRAFT_111346Help
Entry
GLOTRDRAFT_111346 CDS       T03130                                 

Definition
(RefSeq) DAO-domain-containing protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00564  Glycerophospholipid metabolism
gtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GLOTRDRAFT_111346
Enzymes [BR:gtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GLOTRDRAFT_111346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N Pyr_redox Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 19299379
NCBI-ProteinID: XP_007866902
JGI: Glotr1_1_111346
UniProt: S7Q3Q3
LinkDB All DBs
Position
Unknown
AA seq 762 aa AA seqDB search
MLRGKILNRRTLAVASGAAVATVGGGYYFLNSGPAYPDTTRETRRPPPPWTPPSRETMLN
SLKEGGDEGKFDLLIVGGGATGAGVAVDAATRGLKVALVERDDFASGTSSKSTKLVHGGV
RYLQKAVMELDYEQYKLVKEALHERKVFLETAPYLSHMLPIMLPIYKYWQVPYYWVGCKM
YDILAGKENMESSYLMSRGKALETFPMLKSQGLVGALVYYDGQHNDSRMNMALVMTAVKH
GATAANYVEVIQLRKDEKGQLCGARVKDKLTGEEWDVKARGIVNATGPFSDTLLKLDNPS
HTPIVQPSSGVHITLPNYYSPRTMGLLDPATSDGRVIFFLPWQGNTIAGTTDTPCEVESE
PRAQEEDIRWVLEEVRHYLSPDIKVRRGDVLSAWSGLRPLVRNPNAASTEGLVRNHMIHL
SDSGLLTIAGGKWTTYREMAEETVDKAVEAFGLKDRCRNGCVTEKVRLVGSDGWSRNMFI
GLIQRYGLETDVAKHLSDDYGDRAWTVCSLAEPTGQAWPLHGVRLASQYPYIEAEVRYAC
RNEYAQTAVDVIARRTRLSFLNAQAALRALPRVIDIMTEEYGWSHSRRKQEIERATKFLN
SMGIPPETPAPQLIPHGLIEKSENFLWSLSSMVFGGLGLGKKHGAAPVLYSRAQFDAGEV
EALRDAFKSHAKTVASPDGQTVERLRKDQVKELLKDIPGYENASTKDYDYVFEEAGFALR
PDLDMDEFLEVCAELKEVTVPPTPAIKAERRTIPVEKSGGGV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggggaaaatcttgaatcgcaggacgctggccgtcgcatcgggtgcagctgtc
gccaccgtcggcggggggtattattttctgaattcggggcccgcttaccctgatacgacg
agggagacaaggaggccaccgccgccatggaccccgccctcgcgggaaacgatgttgaat
agtctcaaggagggcggcgatgaggggaagttcgatctactgattgtgggaggaggggcg
acgggcgcgggagttgcggtcgatgctgcgaccaggggtctcaaggtcgcattggtcgag
cgggacgactttgcttctggtacctcgtcgaagtctaccaagctcgttcatggcggcgtg
cggtacctccaaaaagccgtcatggagcttgactacgagcagtacaagctggtgaaggaa
gctttgcacgagcggaaggtcttcctggagactgcgccttacttgagccatatgctcccc
atcatgctgccgatatacaagtattggcaggtcccctactactgggtagggtgcaagatg
tacgacattctggcagggaaggagaatatggaaagttcgtaccttatgagcagaggcaag
gccctcgagaccttccccatgctgaagagccagggactggttggtgcattggtttactac
gatggccaacataatgactcgcgaatgaacatggcgctggtcatgaccgctgtgaagcac
ggagcaacggctgctaactacgtggaagtgatacaattgaggaaggacgaaaagggccag
ctgtgcggggcacgggtgaaggacaaactgaccggtgaggagtgggacgtcaaagctagg
ggcatcgtgaatgccacaggtcctttctccgacactctgctcaagcttgacaacccgtcc
cacacgccaatcgtgcagccgtcctccggcgtccacatcaccctacccaactactactcg
cctcgcaccatggggctgctcgatcccgcaacttcagacggacgcgtgatcttcttcctg
ccgtggcagggtaacaccatcgcgggcacaactgatactccctgcgaggtcgagagcgag
cccagagcgcaggaggaggacatccgttgggtgctcgaggaggtgcggcattacctctcg
cccgacatcaaggtacgccgtggggatgttctgtctgcatggtcgggcctccgcccgctc
gtgcgcaacccgaatgcggcgagcacggaggggctggtccggaaccacatgatccatctc
agtgacagcggcctgctcacgattgcgggcggcaagtggaccacgtaccgtgagatggct
gaggagacggtggataaggcagtcgaggcgttcgggctcaaggaccggtgtaggaacggc
tgtgttacggagaaggtcaggctcgtgggcagtgatgggtggagtaggaatatgttcatt
gggctgatccagaggtacggcttggagacggacgtcgccaagcacctgtccgacgactat
ggtgaccgggcatggactgtatgctccctagctgagcccaccggtcaagcgtggcccctc
cacggagtccggttagccagtcaatacccttatatcgaggccgaggtgcgctacgcctgc
cgcaacgagtacgcgcagaccgccgtggatgtgatcgctcgccggacccgtctgtcattc
ttgaacgcccaagctgcactgcgtgctctcccgagagtcatcgatatcatgaccgaggaa
tacggctggagccacagccgcaggaagcaggagatcgagcgggcgacgaagttcctgaat
agtatgggcatcccgcctgagacccctgcaccccaattaattccccacggcctcatcgaa
aagtcggagaacttcctgtggtcactgagtagcatggtgtttggcggtcttggcttaggc
aagaagcacggcgctgcgccggttctgtacagccgtgctcagttcgatgctggtgaagtg
gaggctctgcgtgacgctttcaagagtcatgccaaaaccgtggcttcgcctgacggacag
acagtcgagcggctgaggaaagaccaggtcaaggaattgttgaaggacattcccgggtac
gaaaacgctagcacgaaagactatgactatgtcttcgaagaggccggtttcgcgctccgc
ccagatctggacatggacgagtttttagaggtgtgcgctgagctgaaggaggttactgtc
ccgcctacgccggcgatcaaagccgagaggaggacaatccctgttgagaagagcggtgga
ggtgtataa

DBGET integrated database retrieval system