KEGG   Gloeophyllum trabeum: GLOTRDRAFT_119185Help
Entry
GLOTRDRAFT_119185 CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00052  Galactose metabolism
gtr00500  Starch and sucrose metabolism
gtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GLOTRDRAFT_119185
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_119185
Enzymes [BR:gtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     GLOTRDRAFT_119185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 19300541
NCBI-ProteinID: XP_007861518
JGI: Glotr1_1_119185
UniProt: S7QPM1
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MFAGVSLALLLFASYAAGRAPSPLQRKLLPETFVVDDSAYSLNVSSCPGYTLSGLKETQT
GLTANLVLAGPACNAFGHDIANLTIDVIYETLNRVHVKIYDTANEQFTIPESVVERPAPP
TLSFQNSSDLVFNYESSPFAFWITRRSQPDATPLFDTRISSLPPTPIAPVVNSSDPSLAL
DGFPLVFEDQYLQIASALPLGANIYGLGEVVASSGFRRDIGTDGGVGTVQTLWARDVADP
IDQNMYGSHPVYLEHRYDPTANTSQTHGVFILTSAGADILLATPPSSNVSLIEYRLLGGI
FDFYFFSGPTPQTVIEQYGAVVGLPTWQPAWGFGFHLCRWGYYDINETRAQVTAMREANI
PLEVQWNDIDLYHAYRDFTSDPVTYPGDEMRAFIQELAANNQHYIPILDAAVAHTVNSSD
VYDPYTRGSELDVFIKNPDGSEYIGQVWPGYTVFADWFANNAQEWWTEAMRNWSDSGVEF
SGIWLDMNEPSSFCEGSCGSSANLTNTSTPFLLPGTPGAEVTGYPECYNPTIFGPSGNIT
VNGTNTCNPGETVVKRGLGAGNESGVNLNDPPYAIHNGAGRLSVNTVATNATHAPGYVEL
DVHNMWGFMEEKATHLALQSLRPGKRPFIIARSTFPSTGRWSGHWLGDNFSQWRYMYYNI
QGVLQFQIFQIPMVGADTCGFNDNTDEELCNRWMQLSAFVPFYRNHNTKGAISQEPYRWE
SVANASRTAISVRYSLLPYWYTLFANASIYGSPPVRALFYEFPTEPELFSVDRQFLVGRD
ILVTPVLTPNVSTVDGIFPGRGSVTWRDWYTHDVVNATVGANTTLDAPLGHINVHIRDGS
ALLLHAAPAYTIEETRQGPYSLLVSLASDGSAFGTAYVDDGESYPLGPNRTITFQVADGE
LNVASQGTYDIAQQLTQLIVLGTQQPTQVTVKGEGVQGWDYLPDQEKLVVQGLNLTLNEA
SVVAWK
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccggggtatcccttgctctgctcttgttcgcgagctatgctgccggcagagcg
ccttcgccccttcagcggaagctcttgcctgagacgtttgtagttgacgactcggcatat
tctctgaatgtgtcttcttgtccagggtacactctcagcggcctcaaagagacgcaaaca
ggacttacggcgaacttagttctcgccggcccagcatgcaatgcattcggtcacgacatc
gctaacctgaccatcgacgtgatttacgaaacattaaacagagtacacgttaagatttac
gacacagctaacgaacagttcaccatcccggagtcggtcgtcgaaagaccggctccgcct
actttgtcgttccaaaattcgtcggacctagtatttaactacgagtcttcgcccttcgcg
ttctggattactcggcggtcccaaccagacgcgacgcccttattcgatacgcgcattagc
tctctgcccccgacccccatcgccccagtggtgaactcgagcgatcctagtcttgcattg
gacgggtttcctctagtttttgaggatcagtatttacagatcgcatcagccctaccatta
ggtgccaatatatacggtctcggggaagttgtcgcaagcagcggtttcaggcgcgacatt
ggtactgatggtggtgtcggcactgtccaaacgttatgggctcgagacgttgccgacccc
attgaccaaaacatgtacggatcgcacccagtatacctggagcatcggtacgatcccacc
gcgaacacgtcgcagacgcacggcgtcttcattctcacgtccgccggcgcagacatactc
ctcgcgaccccgccctcctcgaacgtctcactgatcgaataccgcctcctcggcgggatc
ttcgacttctacttcttctccgggccgaccccgcagaccgtgatcgagcagtacggcgcg
gtcgtcggcctcccgacgtggcagcccgcgtggggcttcgggttccacctctgccggtgg
gggtactacgacataaacgaaacgcgtgcgcaggtgacggccatgcgggaggcgaacatc
ccgctcgaggtgcaatggaacgatattgatttgtaccacgcgtatcgcgatttcacaagc
gatccggttacgtaccccggcgacgagatgagggcgttcatccaggagttggctgcaaac
aatcaacactatatcccgatccttgacgctgcggttgcccataccgtaaattcctcagac
gtctacgatccgtatacgcgagggtccgagctagacgtcttcataaagaatcccgatggc
tctgagtacatcggtcaagtctggccgggttacacggtattcgccgattggtttgcgaac
aacgcgcaagagtggtggaccgaggcgatgcgcaactggtctgacagcggcgtcgagttt
tcgggtatatggcttgacatgaacgagccgagctccttctgtgagggatcatgcggatcc
tcggctaaccttaccaacacgagcacgccgttcctcctgccagggacacccggagcagaa
gtcactggataccccgaatgctataacccaacgatattcggacctagtgggaatatcaca
gtcaatggcacgaacacgtgcaatcccggtgagacagtggtcaaacgtggtctcggtgcc
gggaatgagagcggtgttaacttaaatgatcccccgtatgccattcacaacggtgccgga
aggctgtcggtgaacactgtggcgaccaatgcgacccatgccccgggctatgtagaactc
gatgtccacaatatgtggggcttcatggaggaaaaggcaacgcatctggctttgcagagt
ctccggccaggcaagcgtccgttcatcatcgcgaggtcgacattcccgtccactggcagg
tggagtgggcattggcttggcgataacttcagtcaatggcggtacatgtactacaatatc
cagggcgtgctccagtttcagatcttccagatcccgatggtgggtgccgatacgtgcggg
ttcaatgacaataccgatgaggagctatgcaatcggtggatgcaactttcggcatttgtt
cctttctacagaaatcacaatacgaagggagccatctcgcaggagccctaccgatgggag
agcgtggcgaatgcctcgcggactgctatctctgttcggtattctcttttgccttactgg
tacaccctctttgcgaatgcgtcgatctacggatctccccccgtccgcgctttgttctat
gagttccccacagagcctgagcttttctcagtcgaccggcagttcctggtcgggcgtgat
atcttagtcactcctgtgttgactccgaatgtttccactgtggacggtatattccctggc
cgagggtcagtcacttggcgcgactggtatactcacgacgtcgtgaacgcaaccgttggc
gctaacacaacactcgacgcaccccttggacacatcaatgtccacatccgagatgggagc
gcccttctattgcacgcagctccagcgtataccattgaggagacgaggcagggtccttat
agtctgctggtctccctggcttcggacgggagtgccttcgggacggcctatgtggacgac
ggcgagagttatccactgggtcccaacaggacgattaccttccaggttgcggatggcgag
ttgaatgtcgctagccaggggacgtacgacattgcacagcagctcacacagctgatcgta
ctcggcacacagcagccgacccaggtaacggtgaagggagagggggtgcagggctgggat
tacctgccggaccaggagaagctggtggtccagggtttgaacttgacgttgaatgaggca
tctgtcgtagcatggaagtga

DBGET integrated database retrieval system