KEGG   Gloeophyllum trabeum: GLOTRDRAFT_132578Help
Entry
GLOTRDRAFT_132578 CDS       T03130                                 

Definition
(RefSeq) isocitrate dehydrogenase NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00020  Citrate cycle (TCA cycle)
gtr00480  Glutathione metabolism
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
gtr01130  Biosynthesis of antibiotics
gtr01200  Carbon metabolism
gtr01210  2-Oxocarboxylic acid metabolism
gtr01230  Biosynthesis of amino acids
gtr04146  Peroxisome
Module
gtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLOTRDRAFT_132578
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLOTRDRAFT_132578
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GLOTRDRAFT_132578
Enzymes [BR:gtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GLOTRDRAFT_132578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19302529
NCBI-ProteinID: XP_007869663
JGI: Glotr1_1_132578
UniProt: S7RBY2
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MARLQQKIAVKNPVVELDGDEMTRIIWKKIREELILPYLELDIKYYDLGLEYRDATNDQV
TVDAANAILEHKVGIKCATITPDEARVKEFNLKQMWKSPNGTIRNILGGTVFREPIILEK
IPKPVPGWVKPIVIGRHAFGDQYRATDFIAPGPGKLQLVFTPDNGGEKTTLDVYDFKGKG
VALSMYNTDDSISGFAHSSFKMALSKKMTLFMSTKNTILKKYDGRFKDIFQEIYDTQYKS
EFEKLGIYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELIT
PDGDVVESEAAHGTVTRHYREYQKGNETSTNPVASIFAWTRGLIHRAKLDGNDALRQFCQ
DLEAACVEVIDQEGIMTKDLALAIHGKNMKREHWVLTNEYMDAVGKRLNSKLASRGAKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctagattgcagcagaagattgctgtaaagaacccggtcgtagagctagacggagat
gagatgacaaggatcatatggaagaagatccgagaggagctcatcttgccttatctagaa
ctagatatcaagtattacgatctaggactggaataccgtgatgcaacgaacgaccaagta
acggtagacgctgcaaatgccatccttgaacacaaggttggtatcaagtgcgctaccatc
acccccgacgaggctcgtgtcaaggaattcaacctgaagcagatgtggaagagtccaaac
ggaactatccgtaacattctcggtggtaccgtattccgtgaacccatcatcctcgagaag
attcccaagcccgtgcctgggtgggtcaagcccattgtcattggacgtcacgctttcggt
gatcagtaccgtgcaaccgacttcattgcaccaggccccgggaaactccagcttgtcttc
actccggataacggaggcgagaagacgactctggatgtttatgatttcaagggcaaaggt
gttgccctgagtatgtacaacactgacgactcaataagcggtttcgcgcactcctccttc
aagatggctctgtccaagaagatgacgctgttcatgtcgacgaagaatactatcttgaag
aagtacgacggtcgcttcaaggatatattccaggagatctacgacacgcaatacaagtcg
gaattcgagaaactcggcatctactacgagcaccggctgatcgacgacatggtcgcacag
gcaatcaagtcctcgggcgggttcgtctgggcgtgcaagaactacgacggcgacgtacag
tccgacatcctcgcgcagggcttcggcagcctgggcatgatgacctccgagctaataaca
ccggatggcgacgtcgtcgagagcgaggccgcgcatgggacggtcacgcggcactaccgc
gagtaccagaagggcaacgagacgtcgacgaaccccgtcgcgagcatcttcgcgtggacg
cgtggtctgattcaccgcgcgaagctggacgggaacgacgccctccgccagttctgccag
gatttggaggcggcatgcgtggaggtgattgaccaggaggggattatgacgaaggatctt
gcgctggcgatccatgggaaaaatatgaagcgggagcactgggtgctgacgaatgagtac
atggatgctgttgggaaacgcctcaactccaagcttgcttcgcggggcgcgaagctctaa

DBGET integrated database retrieval system