KEGG   Gloeophyllum trabeum: GLOTRDRAFT_141263Help
Entry
GLOTRDRAFT_141263 CDS       T03130                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00010  Glycolysis / Gluconeogenesis
gtr00051  Fructose and mannose metabolism
gtr00052  Galactose metabolism
gtr00500  Starch and sucrose metabolism
gtr00520  Amino sugar and nucleotide sugar metabolism
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
gtr01130  Biosynthesis of antibiotics
gtr01200  Carbon metabolism
Module
gtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLOTRDRAFT_141263
   00051 Fructose and mannose metabolism
    GLOTRDRAFT_141263
   00052 Galactose metabolism
    GLOTRDRAFT_141263
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_141263
   00520 Amino sugar and nucleotide sugar metabolism
    GLOTRDRAFT_141263
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GLOTRDRAFT_141263
Enzymes [BR:gtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GLOTRDRAFT_141263
Membrane trafficking [BR:gtr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GLOTRDRAFT_141263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 19304734
NCBI-ProteinID: XP_007870643
JGI: Glotr1_1_141263
UniProt: S7PTS8
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MPASRRGSGTVTLPTGQTLAFHTRTQDEEDLPHATKKTMADHLRKYESLFTLTPQRMRMI
VDAFKDTLEAGLEKHGNTVPMIPTYVFGWPTGNETGEYLAVDLGGTNLRVCLVTLQGAGR
FEITQSKYRLTEDQKQEEGQKLFDFCAECLKTFIDQHVGEEPGMINLKPGEKLPLGFTFS
YPCSQNRIDHGELIRWTKGFGNPNTEGHDVAEMFRKSLQKYDVPADFISLTCDTTGTLIA
SHYVNPKTKIGCIFGTGCNAAYMEKVANIPKIKELNIKDDAEIAINCEYGAFDSFEHEHL
PRTKYDQIVDETSNKPGEQAYEKLISGRYLGEIMRLVICELIDDGVLFLGQETYKIEKSY
AFDTAFLSLMESDPTDELLMIIGIFTHFFALETTLAERQFFRALAKLIGRRAARLSACGI
AAIVSKMGYLDEGCAVGADGSLYNKYPGFADRVHEGLIDVFGDKGRNIVTYHAEDGSGVG
SAIIAAMTKARKEKGLYTHV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatctcgtcgaggaagtggtacggtgacgctgcccactgggcagacgctcgcg
ttccataccagaacgcaggatgaagaggatctcccgcatgcgaccaaaaagaccatggca
gatcatctgcgcaagtatgagagtttgtttacgttaacgccgcagaggatgcgcatgatt
gtggacgcgttcaaggatacgcttgaggccggtttggagaagcatggaaacacggtgcct
atgatcccgacgtacgtcttcggttggccgacagggaacgaaacgggagagtacctggct
gtagatctcggcgggactaacctgcgggtttgtctcgtcaccctccagggcgctgggaga
ttcgagatcacacaatccaagtatcgtctgaccgaagatcagaaacaggaggaagggcaa
aagttattcgacttctgcgccgagtgcctcaagacattcatagatcagcacgttggggaa
gagccgggcatgatcaacctgaagcccggcgagaagctgcccttggggttcactttctct
tacccttgctcacaaaacaggatcgaccacggtgaactgatccggtggacgaaaggcttc
gggaatcctaatacggaaggacatgatgtcgcggagatgttccgcaagtctctccaaaaa
tacgacgtccccgcagactttatctcgttgacatgcgacacgaccggcacactcattgcc
tctcactacgtgaaccccaagacgaagatagggtgtatcttcgggacggggtgcaatgct
gcgtacatggagaaggtcgccaacattccgaaaatcaaggaactcaatatcaaggatgac
gctgaaattgctatcaattgcgaatacggcgccttcgactcgttcgagcatgagcacctg
cccaggacaaagtacgaccagatcgtcgacgagacgtccaacaagccaggcgaacaagca
tacgaaaaactaatctccggacgatacctcggagagatcatgcgtctcgtcatctgcgag
cttatcgacgacggtgtgcttttcctcggtcaagagacatacaagatcgagaagtcctat
gcgttcgatacggcgttcttatcgctcatggaaagcgaccccacggacgagctgctgatg
atcatcggcattttcacgcacttctttgccctggagacaacgcttgccgagcggcagttc
ttccgagccctcgcgaagctcattggccggagggctgcgagactcagcgcgtgcggtatt
gcggcgattgtcagcaagatgggctacctcgacgaggggtgcgcggtgggtgcggacggg
tcgttgtacaataaataccctggctttgcggatcgggtccatgagggcctcatagatgta
tttggagacaagggacggaatatcgtaacataccatgcggaggatgggagtggtgtcggg
agtgcaattatcgcagctatgacgaaggcaaggaaggaaaaggggctgtacacccatgtg
tag

DBGET integrated database retrieval system