KEGG   Gloeophyllum trabeum: GLOTRDRAFT_36485Help
Entry
GLOTRDRAFT_36485  CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr03030  DNA replication
gtr03410  Base excision repair
gtr03420  Nucleotide excision repair
gtr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GLOTRDRAFT_36485
   03410 Base excision repair
    GLOTRDRAFT_36485
   03420 Nucleotide excision repair
    GLOTRDRAFT_36485
   03430 Mismatch repair
    GLOTRDRAFT_36485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gtr03032]
    GLOTRDRAFT_36485
   03400 DNA repair and recombination proteins [BR:gtr03400]
    GLOTRDRAFT_36485
Enzymes [BR:gtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GLOTRDRAFT_36485
    6.5.1.6  DNA ligase (ATP or NAD+)
     GLOTRDRAFT_36485
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GLOTRDRAFT_36485
DNA replication proteins [BR:gtr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GLOTRDRAFT_36485
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GLOTRDRAFT_36485
DNA repair and recombination proteins [BR:gtr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GLOTRDRAFT_36485
   NER (nucleotide excision repair)
    Other NER factors
     GLOTRDRAFT_36485
   MMR (mismatch exicision repair)
    Other MMR factors
     GLOTRDRAFT_36485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 19305710
NCBI-ProteinID: XP_007862911
JGI: Glotr1_1_36485
UniProt: S7QFU6
LinkDB All DBs
Position
Unknown
AA seq 812 aa AA seqDB search
MHKDSGSKQPHLQHPQKSARHGLAYEVIDVDAFDDTVVEAGPSNVGTATTRQPDYDSVKR
TPSPSKSERITKTRPVRDEGAVLRPKIESVPLETPKYGPLIVSPSVFEVDSRVWPPNKTI
PYSLLAHALSTLTTTRSRITILNILTNTLRVILQAHPPSLLPALYLLSNTLAPAYDSVEL
GLGYSVILKAIQHVSGLSSGALKRLYTKTGDPGDVAFEAKSNVRTLVPHPPLLITGVYES
LVQISKAKGPGAAKQKQSLVEKLLVAAKGEEVRFLVRTLFQNLRVGAVRTSILTALARAM
VMTPPASIRDSIAADSPYYASDDLVAAVKHNPLNRLSEKFTNAERLLKQVYVQHPNYGHI
AKALAEGGLEGLPDRVPFTVGIPLLPTLGSPTRSLDEIYDRLEDLPFAAEFKYDGQRAQI
HGWKNAPDGSVAVKIFSRHLEDMTEKARISTSLTSYLFFSDSNLESLIMDTEIVAIDPGN
GDLRTFQELSNRARKDVQVNEIKVVVCVFAFDLLYLNGQVILQEPFRARRSLLRSKFPPV
IPEWRGAARLDHVKSVDSEAGRDAVEEFWQEAVESRVEGLMVKLLDSGQVLTDPSDKKDR
PRRKPLPATYEPDKRTAAWLKLKKDYVTGLGDSLDLVPIGGWHGNGRKHQWWSPILLGLY
NPALGKLVAVCKCMSGFSDVFYKALTEKYADGSENCSRQNLWDVETGGTPQVYFKPQEVW
EIRGADVTVSPVSVAALGLVSDSRGLSLRFPRFMKVREDKSIEQASTPDFLAGMYRSQQG
KGGKGEGVDDGDLLDASMESEPEESEIDLSDS
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaagatagcgggtcaaagcagcctcacttgcagcatccacagaaatcagcgaga
catgggcttgcttatgaagtcatagatgttgacgcatttgacgatactgttgttgaagca
gggccgtcaaacgttggaactgctacaacacggcagccggactatgacagcgtcaagcga
accccgagtccctcaaagtccgagagaattacaaagactaggcctgtgcgcgatgaaggg
gcagtacttcgtcctaagatcgaatctgtccccctggagacaccaaaatatggaccatta
atcgtcagtccgtccgtctttgaggtggacagcagggtctggccacccaacaagacgatc
ccgtactctctgctagcacatgccctgtctacgctcacgacaacaagatcacgcatcacc
atcctcaatatcctgacgaacacgctgagggttatcttacaggcacacccgccttcactg
ctgcctgcgttgtatcttttgtcaaataccctggcacctgcgtatgattctgttgaactt
ggtctcggctattcggtcatcttgaaggcaatacaacatgtatctggcctttcatctggc
gccctgaagcgactctatacgaaaacaggtgatcctggggatgttgcattcgaagcaaaa
tccaacgtccgcacgttggtgccgcacccgcctctcttgattacaggtgtctacgagtcc
ctagttcaaatctcgaaggcgaaggggccgggcgccgccaaacagaagcaatccttagtc
gagaaactactggttgctgccaaaggcgaagaggttcgcttccttgttcggacactcttt
cagaatctcagagtaggcgctgtaaggacaagcatcttgactgctctcgcccgagcgatg
gttatgacacctccggcgagcataagagacagcattgccgccgattcaccttattatgcc
tccgatgatctggtagctgcagtcaaacataaccccttgaatcgcctttctgagaaattt
accaatgcagaaaggttgcttaagcaagtatatgtccaacatcctaactatggtcacatc
gcgaaggcactggctgaaggtggtctagaaggtttacccgatcgtgtcccttttacagtc
ggtatcccacttcttcctactcttggctcgccaactcgctcgttggatgagatatacgac
agacttgaggacttgccgttcgctgccgagttcaaatatgacgggcaacgcgcccagata
cacggatggaaaaacgccccggacggctccgtagcggtgaagattttctctaggcatctc
gaagacatgacagagaaggcacgtatatctacatcgctgacctcctacttgtttttctcc
gacagcaaccttgagtctttaataatggacacagaaattgtggcaatagatcccggcaac
ggagatttgcggacgttccaagaattatctaaccgtgctcgtaaagatgtccaagtgaac
gagatcaaagttgtagtgtgcgtgtttgcttttgatttgctttacttgaacggccaggtc
atacttcaagaacctttccgggcacggcgatctcttcttcgctctaagttccctcctgtg
attccagaatggcgaggtgctgctcgtttggatcacgtgaagtcggtcgatagcgaagcg
ggcagggacgcagtcgaggagttttggcaagaggctgtcgaaagccgtgttgaaggctta
atggttaagctattggacagtggccaggtcttgacagatcccagtgacaaaaaggaccgg
ccacgacggaagcctttgccagctacatacgagccagacaaacggacagctgcgtggctg
aagctcaagaaggactatgtaacgggtctcggagacagtctcgacctggtaccaatagga
ggatggcatggtaatggccgtaaacaccagtggtggagcccaattctgctggggctctac
aatccggcactgggcaagcttgttgctgtgtgcaaatgcatgtccggcttttcggatgtg
ttttataaggctttaaccgagaaatacgctgatggatctgagaactgctcgcgacaaaac
ctctgggatgttgagacaggaggtacgccgcaggtgtacttcaaacctcaagaagtctgg
gagatcagaggtgcagatgtgactgtcagcccagtctccgtggcagcactgggactggtg
tccgactccaggggtctgagtctccgatttccccgattcatgaaagtcagagaagataag
agtattgagcaggcaagcactcccgattttctggcagggatgtatagaagtcagcagggc
aaaggtggaaagggtgaaggagtcgatgacggtgacctactggatgcaagcatggagtcc
gagcccgaggaatcggagatcgacctttctgattcttga

DBGET integrated database retrieval system