KEGG   Gloeophyllum trabeum: GLOTRDRAFT_41048Help
Entry
GLOTRDRAFT_41048  CDS       T03130                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    GLOTRDRAFT_41048
Enzymes [BR:gtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GLOTRDRAFT_41048
Chromosome and associated proteins [BR:gtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GLOTRDRAFT_41048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SRI BROMI DUF4481
Motif
Other DBs
NCBI-GeneID: 19306024
NCBI-ProteinID: XP_007865527
JGI: Glotr1_1_41048
UniProt: S7RN24
LinkDB All DBs
Position
Unknown
AA seq 797 aa AA seqDB search
MSDLATKREETSLTPKLEDDSRPSATPPVSMSSDVKPRPKGPQLIGHLPRAEQEARSTFE
EIPQNHYQYNTLGRSREALESMTCDCQYEHGVDDACDACGDGSDCINRLTQVECLPDDCR
CRAYCQNQRFQRKEYAPIEIVQTEKKGFGLRAADDIPRDAFIYEYVGDVVSHPSFMKRMR
EYAQQGIRHFYFMMLQKDEYIDATKRGGIGRFANHSCNPNCYVAKWTVGARVRMGIFAKR
AIKKDEEITFNYNVDRYGHEAQPCYCGEANCVGFLGGKTQTDIAAMDDLYLDALGITDEV
EKLGLKGSKKRKGKKLDEDYLPVLKPLVEKDVPKVIQAMRQTQSRKVLFKLLHRVKITED
QSALRQLMRLRGFSLMTNILTDYADDEDITKVALECMTTWPLIQRNKVEDSKVDEPVRQC
AETSQNEDIKELAQKLLAHWDTLEVGYRIPKRLKVDGDEEDKSSPTIVYEAEEESRPSKR
SRLEDLIPEIKLDIKPLGRKAASMSTQPLIGLRVEPPPTPSTEFKPSISRKEQLDAVIAE
ATAAYKRAEEEAAKAAAAQAAAAEEKERRKSLSRSHSHKKQSKEDKEALKEKRLQKLVGA
IVVKCMSKYSKQMDYDMFKKHAKGLTTLISDKEKKSNSYKEGKLDSLSEEKTVKIKKFAK
EYIHKLMRKLEKSGQHRRPPHSSSSANGASTSASAMNGDAGHRADEDGPMAMTVEEAMDM
DMDEDDDDAPEQHDGSTASPSTAQADRDRFEDSPDTEPPPSTPADKATDPRRSRWDIGPD
KEQFDIFRGSDTLSVQS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctcgccacgaagcgagaggagacatccttgacgcccaagctcgaggacgat
tcacgcccgtcggccacaccccctgtgtcaatgtcctcggacgtcaagccacggcccaag
ggccctcagctcatcggccatttgcctcgggcagaacaggaggctcgatccacgtttgag
gagatccctcagaaccactatcagtacaatacgttggggcggtcgcgggaggctctggag
agcatgacgtgtgactgtcagtacgagcatggtgtggacgatgcttgcgacgcctgcgga
gatggctcggattgtatcaacagactgactcaggttgaatgtctacctgacgactgtcgg
tgtcgcgcttactgccaaaaccaacggtttcagcgcaaggagtacgcacctatcgaaatc
gtccagactgaaaagaagggtttcggtcttcgggcggcagacgatatacctcgggacgcc
ttcatctacgagtatgttggcgacgtcgttagccatccatctttcatgaagcgcatgcgg
gagtacgcccagcagggtattcgacatttctacttcatgatgctgcaaaaggacgagtat
atcgacgctacgaaaagaggtggcatcgggcgctttgcaaatcactcctgcaacccgaac
tgctacgttgccaaatggacagttggggctcgggtccgtatgggcattttcgccaagcgg
gcgataaagaaggacgaggaaatcaccttcaactacaatgtcgaccgttacgggcatgaa
gcacagccatgctactgtggtgaagccaactgtgtaggcttcctaggtggcaagacacag
acggacattgctgccatggatgacttgtatctcgatgcactgggcatcaccgacgaggtt
gagaaacttggcctcaagggtagtaagaaaaggaagggcaagaagctcgacgaggactat
ctgcccgttctcaagcctcttgtggagaaggacgtgcctaaggttatacaggccatgcgg
cagactcaaagtcggaaggtcctcttcaagctacttcatcgagtcaagattaccgaggac
caatccgctctccgacaacttatgcgccttcgtggtttcagtctcatgaccaatatcttg
actgattatgcggacgatgaagacattactaaggttgccctggagtgcatgacaacatgg
cctctgatccaacgcaacaaagtggaggactccaaggttgacgagcctgtgaggcaatgt
gcggagacgtcgcaaaatgaggacatcaaggagttggcccagaagctcttggcacactgg
gatactctggaggttggctaccgtataccaaagcgcctgaaagtggatggcgatgaggaa
gacaagagctctcctaccatcgtctacgaggctgaggaagaatcgcggccatcgaagagg
tcccgactggaagacctgatccctgaaatcaagttggacattaagcctctcggacgaaaa
gcggcatccatgtcaacacaacccctcatcgggcttcgagtagaacctccaccgacgcca
tccacggaattcaaaccttcgatctcgcggaaggagcagctcgatgctgttattgcagag
gccactgctgcttataaacgagcggaagaggaggctgccaaggctgccgccgcacaggcc
gctgctgctgaagagaaagagaggagaaaatcattatctcggtctcactctcataagaag
cagagcaaagaggataaagaggcgctaaaggagaaacgtctgcagaaactcgtcggcgcg
attgtcgtgaagtgcatgtctaagtactcgaaacagatggactatgacatgttcaagaaa
catgccaaagggcttacaacgctgatctcggacaaggaaaagaagtctaatagctacaag
gagggcaagctggactctttatccgaggagaagactgtcaagatcaagaaatttgccaag
gagtacatccataagctcatgcggaagttggagaaatctggacagcatcggcgccctccc
cattcctcctcatcggctaacggagcgtctacatccgcatctgcaatgaacggcgacgct
ggtcaccgcgccgatgaggacgggccgatggcaatgacggtagaggaagccatggacatg
gacatggatgaagacgacgacgacgcgcctgaacaacatgacggttcgactgcctcgcct
tcaacggcgcaagcagatagagaccgcttcgaggactcgcccgacacggagccgccgccg
tccacacctgccgacaaggctacggacccacgtcgctcacggtgggacattggacccgac
aaggaacaattcgacatcttcaggggttctgatacattgtctgtgcaatcgtaa

DBGET integrated database retrieval system