KEGG   Gloeophyllum trabeum: GLOTRDRAFT_42029Help
Entry
GLOTRDRAFT_42029  CDS       T03130                                 

Definition
(RefSeq) glutathione-S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLOTRDRAFT_42029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gtr02000]
    GLOTRDRAFT_42029
Enzymes [BR:gtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GLOTRDRAFT_42029
Transporters [BR:gtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   GLOTRDRAFT_42029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 19306100
NCBI-ProteinID: XP_007866113
JGI: Glotr1_1_42029
UniProt: S7Q590
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MGVPDEKIHPHATGAAAKTVAQHEQPQDLVFYAGWFCPFVQRSWVVLEEKGIPYQYKEVN
PYKKEKHFLDINPKGLVPAIEYKGKALYESLIICEFLEEAYPDHTPHLLPSDPFERAIVR
LQLDHVSKAILPAFFRTLQAQEKDKQEAGLQELYSGLRQLAQKVKGPYFLGEQFSLVDVA
IAPWAVRDYILAEHRGYKREDVGNGWKEWAEKLESRDSLVKTSSQHYEEIYGRYLRDEAQ
SEAAKATRAGRVIP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcctgatgagaagattcacccgcatgcaacgggggcagctgcgaagaccgta
gctcagcatgagcagccacaagatctggtgttctatgctggatggttctgtcctttcgta
cagcgtagctgggtcgtcctcgaagagaaaggcatcccttaccagtataaagaggtcaac
ccgtataagaaagagaaacactttttggacatcaatccgaaagggttggtaccggccatt
gaatataaggggaaagcgctgtatgagtcgctgattatctgcgaatttctcgaggaggca
tacccagaccacactccacatctcctcccttctgatccattcgaacgcgccatcgtgcgt
ctccaattggatcatgtaagcaaggccatccttcccgccttcttcaggaccctgcaggcg
caggagaaggataagcaggaagcgggtctgcaagaactgtatagcggcctgaggcagctt
gcgcagaaggtcaagggaccgtacttcctcggcgagcagttcagcctggtcgacgtcgct
atcgcaccgtgggctgtgagggactacatacttgcggagcacagagggtacaagagagag
gacgtcggaaacgggtggaaagaatgggccgagaaactcgagagtcgtgacagcctcgtc
aagacctctagccaacattacgaggagatctatggccgctaccttcgcgacgaagctcag
agcgaagccgcgaaggctaccagagccggcagagttatcccgtaa

DBGET integrated database retrieval system