KEGG   Gloeophyllum trabeum: GLOTRDRAFT_57482Help
Entry
GLOTRDRAFT_57482  CDS       T03130                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00250  Alanine, aspartate and glutamate metabolism
gtr00410  beta-Alanine metabolism
gtr00430  Taurine and hypotaurine metabolism
gtr00650  Butanoate metabolism
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
Module
gtr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GLOTRDRAFT_57482
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GLOTRDRAFT_57482
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GLOTRDRAFT_57482
   00430 Taurine and hypotaurine metabolism
    GLOTRDRAFT_57482
Enzymes [BR:gtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GLOTRDRAFT_57482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19307178
NCBI-ProteinID: XP_007863065
JGI: Glotr1_1_57482
UniProt: S7QGV1
LinkDB All DBs
Position
Unknown
AA seq 543 aa AA seqDB search
MVLSKHINPDRLMQGAQDKHFKHHNLTGTDPNSINHAYGARYSTEPIPKYKIASKGTDAQ
SAYQLIHDELALDGSPTLNLASFVHTWMPEPADKLMRENMSKNLIDQDEYPMTQVIHERC
VSILADLWHAPSSHNAIGTATTGSSEAIQLGGLAMKRLWQERRKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFEVECRLVPVSVESKYRLDPKKAMEYIDENTIGVYVILGSTYTGHYE
PVKEMSALLDEYEAKTGHFVPIHVDAASGGFVAPFATPKLEWDFKIPRVVSINTSGHKFG
LSYVGVGWVIWRDKAHLPKDLIFELHYLGSVEYSFSLNFSRPAHPIIGQYFNFVHLGFEG
YRSVALDDLKNARILSRALERSGYYTVLSDIHRQIGAGGVSGAVSKVLDEENVENYEPGL
PVVSFRFTDEFKQKYPDIQQKWIQILLRSRGWIVPNYELPPDLESIEILRVVVRESMTAV
LVERLVADIVEITEDLMKQDSPAHALSALSLHAKPQQNNSKAHTGKLEEGSGSKPSGTYA
KTC
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctcaaagcacatcaaccccgacaggctcatgcagggagcccaggacaagcac
tttaagcaccacaacctcaccggcacagaccccaactccatcaaccatgcctacggcgcc
cgctacagcaccgagcccatcccaaagtacaagatcgcgtcaaagggaaccgatgcccag
tcggcttaccagcttatccacgacgagctcgccctcgacgggtctcccaccctcaacttg
gcttcctttgtccacacctggatgcccgagcccgccgacaagctcatgcgcgaaaacatg
tccaagaacttgattgatcaggatgaataccccatgactcaggtcatccatgagcgatgc
gtctcgatcctcgctgatctctggcacgcccccagctctcacaacgccatcggcacggcc
accactggctcttccgaggccatccagctcggtggactcgccatgaagcgtctctggcag
gagcgccgcaaggccgccggcaagtccatccacgagcccggacccaacatcgtcatgggc
gccaacgcccaggtcgccctcgaaaagttcgcgcggtactttgaggtcgagtgcaggctc
gtccccgtcagcgtcgagagcaagtacaggctggacccgaagaaggccatggagtatatc
gatgagaacaccatcggcgtgtacgtcatcctcgggagcacgtataccggccactacgag
ccggtcaaggagatgtcggccttactcgacgagtacgaggcaaagaccgggcactttgtc
cccatccacgtggacgcggcctctggaggcttcgtggctccttttgccacgcccaagctg
gaatgggactttaagatccctcgtgtcgtctcgatcaacacctctggccataagttcggc
ctgtcgtacgttggtgtcggctgggtcatctggagggacaaggcgcacctcccgaaggac
ctcatcttcgagctccactacctcggctcggtcgagtactccttctccctgaacttctcg
cgccccgcgcaccccatcatcgggcagtacttcaattttgtccacctcgggttcgagggc
taccgcagcgtcgcgctggacgacctcaagaacgcgcgcatcctcagccgcgcgctcgag
cggagcgggtactacaccgtgctgagcgacatccacaggcagatcggcgccggcggcgtc
tcgggtgcggtgagcaaggtgctggacgaggagaatgtggagaactatgagcctgggctg
ccggtcgtgtcgttccggttcacggacgagttcaagcagaagtaccccgacatccagcaa
aagtggatccagattttgctgaggagccgtggatggattgtgcccaactacgagctcccg
ccggatctggagagcatcgagatcctgcgtgtcgtggtgagggagagcatgaccgccgtc
ctcgtcgagcggctcgtcgcggatatcgtcgagatcacggaggacctcatgaagcaggac
tccccggcgcacgcgctgagcgcgctgagcctgcacgcgaagccgcagcagaacaactcg
aaggcgcataccggcaagcttgaggagggttctggcagcaagccgagcgggacgtatgcc
aagacttgttga

DBGET integrated database retrieval system