KEGG   Gloeophyllum trabeum: GLOTRDRAFT_61700Help
Entry
GLOTRDRAFT_61700  CDS       T03130                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00500  Starch and sucrose metabolism
gtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_61700
Enzymes [BR:gtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GLOTRDRAFT_61700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19307445
NCBI-ProteinID: XP_007866834
JGI: Glotr1_1_61700
UniProt: S7Q4V9
LinkDB All DBs
Position
Unknown
AA seq 576 aa AA seqDB search
MYRFLVCALGLLGTVLAQSVDSYVGSEGPIAKAGVLANIGPNGSKASGAAAGVVVASPSK
SDPDYWYTWTRDSSLVFKSLIDQYTTGIDSTSSLRSLIDSFVIAEANIQQVSNPSGTLTT
GGLGEPKFNVDETAFTGAWGRPQRDGPALRATALITYGNWLLSNGNTTWVTSTLWPIIQN
DLNYVVQYWNQTTFDLWEEVNSSSFFTTAVQHRALREGAAFATKIGQTSSVSSYTTQAAN
LLCFLQSYWNPTSGYITANTGGGRSGKDANTLLASIHTYDPSAGCDATTFQPCSDKALSN
LKVYVDSFRSVYSINSGIASNAAVATGRYPEDSYQGGNPWYLTTFAVAEQLYDALNVWAA
QGSLNVTSISLPFFQQFSSSVTAGTYASSSTTYTTLTSAIKSFADGFVAINAQYTPSNGG
LAEQFSRSNGSPVSAVDLTWSYASALTAFEARNNTQFAGWGAVGLTVPTSCSSNSGGGGG
STVAVTFNVNAQTVWGENIYITGSVDALSNWSPDNALLLSSANYPTWSITVNLPASTAIQ
YKYIRKNNGAVTWESDPNNSITTPASGSVTENDTWR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcttcctagtctgtgctctcgggcttctggggacagtcctcgctcagtcagtc
gacagttatgtcggcagcgaaggccccatagcaaaggccggcgtccttgccaacattggg
ccgaacggctcaaaggcctctggtgcagccgccggcgtggtggtggctagccccagcaag
tcggatcccgactattggtacacttggacgcgtgactcgtcactcgttttcaagtctctc
attgatcagtacaccactggtatcgacagcacgagttcgctgaggtctctgatagacagt
ttcgttattgccgaggccaacattcagcaggtctctaatcccagcggcactcttactacc
ggcggcttgggagagccaaaattcaatgtcgatgaaactgcattcaccggtgcatggggt
cgaccccagcgcgacggacctgcgctccgtgcgactgctttgatcacctacggtaactgg
ctcttgtcaaacgggaacacgacctgggttaccagtacgctgtggccgatcatccagaac
gatctcaactacgtcgttcagtactggaaccagaccaccttcgacctctgggaagaagtg
aactcttcctcgttcttcaccactgcagtgcagcaccgtgccttgcgcgaaggcgcagcc
ttcgctaccaagatcggtcagacctcctcggtcagcagctacacaacccaagcggcgaat
ctactttgctttttgcagtcttactggaaccccacttccggatatatcaccgctaacact
ggcggtggtcggtccggcaaggacgccaacaccctcttggcatccatccacacttacgac
cccagcgcgggctgcgatgccacgaccttccagccctgctccgacaaagccctctcgaat
ctgaaggtttacgtcgactccttccgttctgtctactccatcaacagcggtattgcctct
aacgccgctgtcgccactggtcgctacccggaagacagctaccagggcgggaacccatgg
tacctcactacgttcgccgtcgccgagcagctctatgacgccctcaatgtctgggctgct
cagggctccctcaatgtcacctccatctccctccccttcttccagcagttctcctctagt
gtcactgccggcacttacgcttcgagctccaccacttacacgactctgacctccgccatt
aagagcttcgcggatggattcgtcgctatcaacgcccagtacacgccgtccaacggtggc
ctcgctgagcagttcagcaggagcaacggctctcccgtcagcgctgttgacttgacatgg
agctatgcatccgcattgaccgcgtttgaagcgaggaataatactcagttcgccggctgg
ggcgcggtaggtttgactgtgccgacctcgtgctccagcaacagtggtggaggcggagga
tcgactgtcgccgtgacgttcaacgtgaacgcccaaacggtttggggcgaaaacatctac
atcactggctcggttgacgctctgagtaactggtctcccgacaacgccctcttgctctcg
tccgccaactacccgacctggagcattaccgtgaatttacccgcgagcactgccattcag
tataagtatattcgcaagaacaacggagctgtcacctgggaatccgatcccaacaacagc
ataactactccagccagcggctccgtgaccgaaaatgacacctggcgttaa

DBGET integrated database retrieval system