KEGG   Gloeophyllum trabeum: GLOTRDRAFT_63876Help
Entry
GLOTRDRAFT_63876  CDS       T03130                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00500  Starch and sucrose metabolism
gtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_63876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gtr01003]
    GLOTRDRAFT_63876
Enzymes [BR:gtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GLOTRDRAFT_63876
Glycosyltransferases [BR:gtr01003]
 Polysaccharide
  Storage polysaccharide
   GLOTRDRAFT_63876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 19307574
NCBI-ProteinID: XP_007868488
JGI: Glotr1_1_63876
UniProt: S7PZV3
LinkDB All DBs
Position
Unknown
AA seq 735 aa AA seqDB search
MSEPIKRDIRNPILFECAWEVANKVGGIYTVIKTKVPVTVSEFGDRYCLIGPLSYKTAPM
EVEAEEPSDPDLAASLDAMRAKGVKCLYGRWLIEGAPHVLLFDTGSQYSRLDEWKGDLWN
LAGIPTPPNDHETNETVVFGYLVAWFLGEYVARQLHTAVIAHFHEWQAGLAIPLCRKRHI
DVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHQTAKQKIHDFIRGHFYGHY
DFDLDNTLYMFTAGRYEYRNKGVDMFIESLARLNYRLQKANSKMTVVAFIIMPAATSSYT
IEALKGQAVTKQLRDTVTEIQNRIGMRLFEHAMRSNGEHGIMPTPDDFLSEEDKVLLKRR
IFALKRNSLPPITTHNMVDDANDPILNQIRRVQLFNHSHDRVKIIFHPDFLNSNNPILGL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIERPEDEGCY
IIDRRMQSVEDSVNSLTTCMFQFCNKTKRQRINQRNRVERLSPLLDWKNLGMEYSKARQL
ALRRAYPDAFYGNDEEEFDFGAGIDRMMPSVPPSPRFRMSGMATPGDIGTLTEEMERLKT
SDYRGFNWPSQQEDEEEGYPFPLVMKVRSRASSVVSGASTPGGGTFRSLTENDLRKADAA
LSNVGDAPVNGVNGK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccatcaaacgcgacattcgcaaccccatcctcttcgagtgcgcctgggag
gtcgccaacaaagtcggcggaatctacaccgtcatcaagacgaaggtccccgtcaccgtc
tcagagttcggcgacaggtattgccttatcggccctctcagctacaagacggcacccatg
gaagtcgaggcggaggagccctcagaccccgatctagcagcgtccctggacgcgatgcgc
gctaagggtgtcaaatgcttgtatgggcgatggttgattgaaggcgctccgcatgtcctg
ctatttgataccggcagtcagtactcacggttggatgagtggaagggcgacctctggaat
ctcgctggtatccctacccctccaaacgaccacgagacgaacgagacagtagttttcggg
tacctggttgcatggttcctcggcgagtacgttgctcgccaacttcataccgcggtcatc
gcgcacttccacgaatggcaggctggtctcgcaatcccattgtgccggaaacgacacatc
gacgtgacgactgtattcacaacccacgccaccctcctcggacggtatctgtgtgctggc
tccgtggacttctacaacaacctccagtactttgatgtcgaccacgaagctggcaagcgc
ggtatctaccaccgttattgcatagaacgctcctccgcccactgtgccgatgttttcacc
accgtctctcacatcaccgcctatgaatccgagcatctgctcaaacgcaaacctgacggc
gtcctgccgaacggcctgaacgtcgtcaagttccaggctatgcacgagttccaaaatcta
catcaaaccgcaaaacaaaagattcacgacttcatccgcggacatttctacggccactat
gactttgacctcgataacacgctctacatgttcaccgccggtcggtatgagtatcgaaac
aagggtgtcgatatgtttattgagtcattagcacgtctgaattatcgcctgcaaaaggcg
aactccaagatgacggttgtcgcatttatcatcatgcctgcagccacttcctcgtataca
atcgaagccttgaagggtcaagccgtcacaaagcaactgcgtgatactgtcacggagatc
caaaatcgtatcgggatgcgactattcgagcatgccatgcggtccaacggggaacacggt
attatgcccacgccagacgacttcctttcagaagaagacaaagtcctcctgaaacgccgg
atctttgcactcaagcgcaactcgctcccgccgattacgacgcacaacatggtcgacgac
gccaatgaccctatcctgaaccagatccggcgagtgcagctgttcaatcactcgcacgac
cgcgtgaagatcatcttccaccccgattttctgaattcgaataaccccattctgggtctc
gactatgaggagttcgtccgtggttgccatttgggcgtgttcccgagttattatgagcca
tggggatacactcctgcggaatgtacagtcatgggtataccctcgatcacgaccaacctc
tctggtttcggctgcttcatgcaagacctgatcgaacgtcccgaagacgagggctgctac
atcatcgacaggcgcatgcagtccgtcgaggactccgtcaactcgcttacgacgtgcatg
ttccagttctgcaacaagacgaagcgccagcggatcaaccagcggaaccgcgttgagcgc
ctgagcccgctgctcgactggaagaacctcggcatggagtactctaaggcgcgccagctt
gcgctgcgccgcgcgtaccccgacgcgttctacggcaacgacgaggaggagttcgacttc
ggtgcgggcattgacaggatgatgccgtcggtgccgccgagcccgcggttcaggatgtcg
ggtatggcgacacctggtgacattgggacgttgaccgaggagatggagcgattgaagact
agtgattaccgagggttcaactggccttctcaacaagaagacgaggaggaaggttatcct
ttccctctcgttatgaaggtcagatctcgcgccagctctgttgtgtcgggcgcaagcact
cccggcggaggtactttcaggagtctcacggagaatgacctgcgcaaggcggatgcggct
ttgagcaacgttggagatgctcctgttaacggcgtgaacgggaaatag

DBGET integrated database retrieval system