KEGG   Gloeophyllum trabeum: GLOTRDRAFT_64852Help
Entry
GLOTRDRAFT_64852  CDS       T03130                                 

Definition
(RefSeq) SWI/SNF complex protein
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
gtr  Gloeophyllum trabeum
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gtr03021]
    GLOTRDRAFT_64852
   03036 Chromosome and associated proteins [BR:gtr03036]
    GLOTRDRAFT_64852
Transcription machinery [BR:gtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     GLOTRDRAFT_64852
Chromosome and associated proteins [BR:gtr03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    GLOTRDRAFT_64852
   PBAF complex
    GLOTRDRAFT_64852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 ZZ SANT_DAMP1_like
Motif
Other DBs
NCBI-GeneID: 19307625
NCBI-ProteinID: XP_007869297
JGI: Glotr1_1_64852
UniProt: S7RD25
LinkDB All DBs
Position
Unknown
AA seq 701 aa AA seqDB search
MDSPKRVGSPSPGSSDAKRIRLTVPQQNQGVEAVDPEIAPGKKSELEPIQGGDIGNLPGE
PPAETRPETGGRVRVLGEGEEDGGDVEMGEGGDDEGDSGEENEDEDPAQLEATRVRLEDQ
ARKYLAAQTHEVIIPSYAAWFDMSKIHSIEKRALPEFFNSRNKSKTPAIYKDYRDFMINT
YRLRPSEYLTVTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDPDSRPATLAPPFTGHYR
VIIDTPRGLQSLHPGTRPPNHPHAQGVNGAPKPGSTSTPASLELRSNIYQTTAKASRPIN
AEQAKELANGASAPGGNGRATASITFQCDTCGVDCTAVRYHSLKVKNFELCPPCYLDGRF
PSTMFSGDFVKLTNAATTSGNAHLSDNDWSDDEILRLLEGVEMYDDDWSLIEEHVGTRSA
QQCIRKFLELPIEDPYLETEGSMGGLRYARIPFEQADNPVMSVVAFLAGVVGPGVAAEAA
KTALHALTDGATKEEEKQDAKPPEAGEGATAGAQGDKMDQDAPSQGQEGASSKPSTPTPP
SNEMVTDKGEEKQPSARIPHSKVVRAADLALKASGKAAGALADAEDAQIRSTLANLIKLT
LTKLELKMAQFEELEDILEEERKALETARQQVVEERVTLKRTLEKVRSELQKNGAAAAAD
ATSQTSLGTSGQGTIVSQVQEGTAMEGDSGPISGGNMAQLS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggattcacctaaacgcgttggctcaccttctcctggctcctccgatgcgaaacggatt
cgtctgaccgttccacagcaaaaccaaggtgtcgaggctgtggatcccgaaattgctcct
ggcaaaaagagtgagctggagccaatacaaggcggggacataggcaatttacccggcgag
ccgcctgccgagacgcgtccagagacaggtgggagagtgcgcgtcctgggggaaggggag
gaagatggcggtgacgtggaaatgggagagggcggcgacgacgaaggagattctggcgag
gagaacgaagacgaggatcccgcacagttagaagcgacgagagttcgtctggaggatcag
gcgcgcaaatacttggctgcccagacgcacgaagtcatcattccctcctacgctgcctgg
ttcgacatgtccaaaattcattccatcgagaagcgcgccctgcccgaattcttcaattcc
agaaacaagtccaagacccctgccatttacaaggactaccgcgacttcatgattaacacc
taccgcctccgcccttcggaatacctcactgttacagcttgcagaaggaacctggcgggt
gacgtttgcgctatcatgcgcgtgcatgctttcttagagcagtggggtctgataaactac
cagattgatcccgactcgcgtcctgccacattggcaccaccattcacaggccactaccgt
gtcattatcgacacaccccgtggacttcagtcgctacaccctgggacgcggccgcccaac
caccctcatgcgcagggcgtgaacggtgctcccaagcccggttccacgtctactccagca
tccctcgaacttcgctccaacatctatcagactacggcgaaagcctcgcggcccatcaat
gctgagcaggcaaaggagctggctaacggtgcttctgctcctggtggtaatggtcgcgcg
accgcatcgatcacgttccagtgtgatacgtgcggtgttgactgtacggccgtgcggtac
cattccctcaaagtgaagaactttgagctctgcccaccgtgttaccttgacggtcgcttt
ccctcgaccatgttcagcggcgatttcgtcaagctgaccaacgctgccaccacgagcggc
aacgcccacctcagcgacaatgactggtcggacgacgagattctccggctgctggagggc
gtggagatgtatgatgacgattggtcattgattgaggagcatgtgggcacgcgatctgcg
cagcagtgcatacgcaaattcctggaactccccatcgaagatccatatctggagacagaa
ggctccatgggcggccttcgatatgcccgtatacccttcgaacaagcagacaacccggtg
atgagcgtcgtcgctttcctggctggcgttgtcggacctggggtcgccgctgaggccgcc
aagacggcattgcatgccctcacagatggtgccacaaaagaggaagaaaagcaggacgcc
aaaccccctgaagcgggtgagggcgcaactgccggcgctcagggtgataaaatggatcag
gatgctccaagtcagggccaagagggcgcttcaagtaaaccgagcactccgacccctccg
tcaaacgagatggtcacggacaagggagaggaaaagcagccttcggcccggatacctcat
tccaaagtcgtccgcgccgccgacctagccctcaaggcatctggcaaggccgcgggggcc
ttggcggatgccgaggacgcgcagatccgctctacgctagcgaacctcatcaaactgact
ctgacaaagctcgagctcaaaatggcacagttcgaggagctggaggatatcttggaggaa
gagaggaaggctctcgagaccgcacggcagcaggtcgttgaggaacgcgtgacattgaag
cgtacgctcgagaaagtgcgtagtgagctccagaaaaatggcgctgccgccgcggcagat
gctacgtcccagaccagcctcggtacgagcgggcagggcactattgtctcccaggtgcaa
gagggcaccgctatggaaggcgactcgggtccgattagcggaggaaatatggcgcaactc
agctga

DBGET integrated database retrieval system