KEGG   Guillardia theta: GUITHDRAFT_134382Help
Entry
GUITHDRAFT_134382 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
gtt  Guillardia theta
Pathway
gtt00620  Pyruvate metabolism
gtt01100  Metabolic pathways
gtt01200  Carbon metabolism
Module
gtt_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GUITHDRAFT_134382
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     GUITHDRAFT_134382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 17308113
NCBI-ProteinID: XP_005838432
JGI: Guith1_134382
UniProt: L1JSN0
LinkDB All DBs
Position
Unknown
AA seq 525 aa AA seqDB search
MAKYYHGHAMQTACEHYGEIPEKAEAIHFDMYHARQIEGVLASHVSRIREETSRGELQTI
VVTDGEDTLDVGDVGTWSAGLGMSKAMMHAAMAGFHPKAILCVVLGDVSSSDDTSRGGDR
LSVARALASSENFDTQRAHSHRLSEPWQQVSAVLPAEVGSIMQVIEEHSKSSPVFNDGLD
GRATIVATRPSSCVTLIHLSVFTLESIGVPTPMAMKGLYTLEDRHHYKSKFRKPLPARLR
GWLSRTTSLHELKSSSCLLGLHRNVSTVVEGIRATILIGASGIRGAFDRDVLRILHKNHE
RPGIIVLSNTQGKAECSSADTWHHTTGNGKTLYVGGDDPLPYRPLGYEGVALIPSRATSL
FVYPGISLATFGEVTQAAGISSITPSMLQVAAETLARMASIDEISYGSLFPRLSLLKDIS
VRIAAEIIRVAQKEQKTNKVVPEGYKELLSFLQSLQDLDADDELVSSYSWQEGEKVEVKV
GGEEGAFLAGAGGLTVDEVSMVAPGQPEDGGSRWSEYERAIPPDK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtactatcatggacatgctatgcagactgcttgcgagcattatggagagatc
cctgagaaggcggaggcgattcattttgacatgtaccatgctcgacagatagaaggagtg
ctggcaagccacgtgagcaggatcagagaagagacgagcaggggagagctgcagacgata
gtggttactgacggggaggacacgctggatgtcggagatgttgggacctggtctgctggg
ctgggaatgagcaaggcgatgatgcacgctgccatggcagggtttcatccgaaggccatc
ctctgcgtcgtacttggtgacgtgtcaagctcggatgacacgtcgaggggaggagatcgc
ctttctgtggcacgagctcttgcgagctctgagaactttgacacccaacgtgctcattca
catcgactgtccgaaccctggcagcaggtgtctgcggtcttgcccgcggaggttgggagc
atcatgcaagtcatcgaggaacattccaagtcctctccggtcttcaacgacgggctggat
ggtcgagcgacgatagtagcaaccaggcccagcagttgtgtcacgctgatacatctgtca
gtcttcacgcttgagagcatcggggttccgactccgatggcgatgaagggactttacacc
cttgaagacaggcatcactacaaatcaaagttcagaaagcccctgccggcgagactgaga
ggttggttgtcaaggacaacttctctacacgagctcaaaagctcatcatgcttgctagga
ctccatcgaaatgtgtcaacagtcgtggaggggatccgagcgacgatcttgatcggagcc
tcggggatcaggggagcgttcgatcgggatgtgctgcgaatcttgcacaagaaccatgag
aggcccggcattatcgtcctctccaacactcaggggaaggctgagtgttcgtcagcggat
acttggcatcatacgacaggcaacggcaagaccctctacgtgggaggagacgaccctctg
ccgtatcgtccactcggctatgaaggagtcgctctcatcccgtcgagggcgacctctctg
tttgtctatccaggaatctcgctggcgactttcggtgaagtcacgcaagctgctggcatc
tcgagcattactcccagcatgttgcaggtcgctgctgaaactttagctcgcatggcatcg
atcgatgaaatctcttacgggagtctgtttcctcgcctgtctctgctcaaagacatctca
gtaaggatcgctgcggaaatcatcagggtagcacagaaggagcagaagacaaacaaggtc
gttccggaaggatacaaagagcttctcagcttcctacaaagcttgcaagacctggatgct
gatgacgagcttgtatcgtcgtacagctggcaggagggtgagaaggtggaagtcaaggtc
ggaggagaggaaggagccttcctcgctggagcaggaggtctgacggttgacgaggtgagt
atggtagcacctgggcagcccgaggatggaggatctcgatggagcgagtacgagagagca
atccccccagacaagtga

DBGET integrated database retrieval system