KEGG   Guillardia theta: GUITHDRAFT_136489Help
Entry
GUITHDRAFT_136489 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gtt  Guillardia theta
Pathway
gtt00562  Inositol phosphate metabolism
gtt01100  Metabolic pathways
gtt04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GUITHDRAFT_136489
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    GUITHDRAFT_136489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gtt01009]
    GUITHDRAFT_136489
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GUITHDRAFT_136489
    3.1.3.48  protein-tyrosine-phosphatase
     GUITHDRAFT_136489
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     GUITHDRAFT_136489
Protein phosphatases and associated proteins [BR:gtt01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    GUITHDRAFT_136489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc DUF4354
Motif
Other DBs
NCBI-GeneID: 17305365
NCBI-ProteinID: XP_005835812
JGI: Guith1_136489
UniProt: L1JKJ9
LinkDB All DBs
Position
Unknown
AA seq 523 aa AA seqDB search
MSISKFEELSASSSMRQRSSFTLHDSSQGEMNAPQADGTSESLAAPAPASRPRSWSQVKS
LWAGQKMRTTLNGFNIDMAYITPHIIALATPVDNKLQKFMKKDSVEEIKQYFEMEHPNKA
KFYNLDGETNSSFLKTYEFNGKITQEYAFLKKEVTLLSRIQSFCKDLQTWLDAEDDNVAV
IMCASGRNRTGLMICSFLIYAWPNEFQSVREAIEFYEKMRMKDAEAFVYNCHRRYIGYFF
TRFAANPSSVDLSKLCLTCDGLDMNKIRIEIFLLNVFSKKSQDQNELQLLWSSKGKDAGS
MKGGRKYLIMSLTELLTMAGDIKISGRKFSVGPFYEICSLWFNTGFIDHSPVVWNKTCFD
FADQDSKAKVPFDFHLQMLFRDRPRVASARQSSQSASFYCFDCQLRAQPVDLSDSDAQEM
DAEGVIQYFRTEAPHRVHPLIDEDCAVCSQRQRKFFTAEKMTASLDSSTISHICRINSME
YFKQQHDSNIGDAPERPLQGCPEPFLRVCKRYLQGSHRQVNDR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataagcaagttcgaggaactttcggcatcaagtagcatgcgccagcgctcctct
ttcactctccacgattcgtctcaaggcgagatgaacgctcctcaagcagacggcacctcg
gagagtctcgctgcccctgcaccagcatcgcgcccaaggtcatggtcgcaagtcaagtct
ctctgggcagggcagaagatgagaacaactctcaacggtttcaacatcgacatggcgtat
atcacccctcacatcatcgcccttgccacccctgtcgacaacaagctgcagaagttcatg
aagaaggattctgttgaggagatcaagcagtactttgagatggagcatccgaacaaagcc
aagttctacaacctggacggggaaacaaactcttccttcctcaaaacgtatgagttcaac
ggcaagatcacgcaggagtacgccttcctcaagaaggaggtcaccttgctttctcgcatt
caaagcttctgcaaggaccttcaaacttggctcgacgctgaggacgataacgtggctgtg
atcatgtgtgcatcgggaagaaaccgaacaggattgatgatttgctcgtttctgatttac
gcatggcccaatgaattccaatcggtcagggaggcgattgaattttatgaaaagatgaga
atgaaggatgccgaagcatttgtatacaactgtcatcgaagatacatcggatattttttt
accagattcgctgcgaatccctcttcagtggaccttagcaagttgtgcctgacatgcgat
ggtttggacatgaacaagatcaggattgaaatatttcttttgaacgtgttcagcaagaaa
tctcaagatcagaatgagcttcagctgctttggtcttcgaaagggaaagatgcagggtcg
atgaaaggaggccggaaatatctcattatgtcgctgactgagcttttaacaatggcgggg
gacatcaaaatctctggaaggaagttctcagttggccctttctacgagatttgcagtttg
tggttcaatactggtttcatcgatcatagccctgtggtgtggaacaaaacttgcttcgat
ttcgccgatcaagacagcaaagcgaaagtcccgttcgactttcacctccagatgttgttt
cgtgacagaccgagggtcgcctccgctcgccaaagcagccagtccgcttcgttctattgt
tttgattgtcagctgagagctcagcccgtcgatctctctgactcggatgcacaggagatg
gatgcggaaggagtgatccagtacttccgcacggaggcgccgcatcgagtacacccgctg
attgacgaggactgcgctgtctgctctcagcgtcagcggaagttcttcacggcagagaag
atgacagcgagcctggactccagcacgatctcacacatctgtagaatcaactccatggaa
tacttcaaacagcagcatgactccaacatcggtgacgcccctgagagaccgctgcaaggt
tgtcctgaacctttcctcagagtttgcaagagatacctccaaggatcccataggcaagtc
aatgatcgctga

DBGET integrated database retrieval system