KEGG   Guillardia theta: GUITHDRAFT_151864Help
Entry
GUITHDRAFT_151864 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K11276  nucleophosmin 1
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gtt03036]
    GUITHDRAFT_151864
Chromosome and associated proteins [BR:gtt03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     GUITHDRAFT_151864
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     GUITHDRAFT_151864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPL OST-HTH YL1 Nop14 SDA1 Nucleoplasmin CDC45 BUD22 NOA36 LTV LAP1C Presenilin Lin-8
Motif
Other DBs
NCBI-GeneID: 17304932
NCBI-ProteinID: XP_005835325
JGI: Guith1_151864
UniProt: L1JJU1
LinkDB All DBs
Position
Unknown
AA seq 300 aa AA seqDB search
MKFWSACIKPSKPFPVEIPDNHTLRLTQCSLGENVKQGKTVLKVKVAGKECVIASLITEK
MEHCVMELMFEEGQIEFITSGQNEIHLAGNMMDNEEGMDGMGGMSDEEEDEDDDFDAKAA
MKGMGKGQDDDEDDEDEDDDGEEDEEMDDDGEGEEEEEEEEEEEEEEKPKPKQSNAGQKR
NAPETKEAPSKQQKTPAKTNPSTPANKKEAASAGTPKTPGSKDVPADVKTKLKNVLAGHS
SGIKGSDFPNEWAKAVKTPLKDTYMKLGFKKLNEFIKACPDVITVEEKGGGNIVYHPKKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctggtctgcgtgcataaaaccgtcaaagcccttccctgtggagatcccggac
aaccacaccttgaggctgactcagtgctctctcggggagaatgtgaagcaggggaagact
gtgttgaaggtcaaagtagcaggaaaggagtgcgtgatcgcgtccttgataaccgagaag
atggagcactgcgtgatggagctcatgttcgaagagggtcagatcgagttcatcaccagc
ggacagaacgagattcacctggctggcaacatgatggacaatgaggagggtatggacggc
atgggaggcatgtcagacgaggaggaggatgaggacgatgacttcgatgctaaggctgcc
atgaagggaatgggaaagggtcaggacgacgatgaggacgacgaggacgaggacgatgat
ggagaggaggatgaggaaatggacgatgacggcgaaggcgaagaggaggaggaagaggaa
gaggaagaggaagaggaggagaagcccaagcctaagcagtcaaacgctggtcaaaagaga
aatgccccagagaccaaggaagcgccttccaagcagcagaaaactcctgccaagacgaac
ccaagcacgccggccaacaagaaagaagccgccagtgcaggcacccccaagactcctgga
agcaaggatgtcccagcggacgtgaagacgaagctcaagaacgtgctggcgggtcactcg
agcggcatcaaggggtctgacttccccaacgagtgggcgaaggcggtgaagactccgctc
aaggacacgtacatgaagctcgggttcaagaagctcaacgagttcatcaaggcctgtccc
gatgtcatcactgttgaggagaagggaggaggaaacatcgtctaccaccccaagaagaag
taa

DBGET integrated database retrieval system