KEGG   Guillardia theta: GUITHDRAFT_155221Help
Entry
GUITHDRAFT_155221 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gtt01001]
    GUITHDRAFT_155221
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GUITHDRAFT_155221
Protein kinases [BR:gtt01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   GUITHDRAFT_155221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 17293279
NCBI-ProteinID: XP_005823514
JGI: Guith1_155221
UniProt: L1IKT4
LinkDB All DBs
Position
Unknown
AA seq 338 aa AA seqDB search
MGCGTSLHLVTSPNQRLPRRSIDGSYRIGKIVGRGTFSVCLQAEALKGGMVVVKKLARSN
VNFNYNNILKEVRIMKKLSHPGLIRLQDYFEDQEAVYLVQELANGGDLFDRVVEGGAIPE
PASVFICRQILYALGYLHENNVCHRDLKPENILFLSSLPGAPGYDIVKITDFGLSTDKAV
GYTDTMSTVCGTPDYTAPELLAAAGTSMEGRMLYSCKVDIWSVGAILYMMLGGKAPFKFT
DSNTTVVLQKILTGEYSFPDKYWENVSDNAIISVRAMMQVDPRMRPTASECLELDWFEED
EERRMQSLGLHAETTSRKTVPDPHARFVLANSLHKPPK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgggacctcgttacaccttgttacgtcgcccaaccagaggcttccacgacgg
agcatcgatggcagctatcgcattgggaagattgtaggaagggggacattctcggtctgc
ctgcaggcggaggcgcttaagggagggatggtggtggtgaagaagctggcaaggtcgaat
gtgaacttcaactacaacaacatcctcaaggaagttcggatcatgaaaaagctctcgcac
cctgggctcattcgacttcaggactacttcgaggaccaggaagcagtttacctggtgcaa
gagctggcgaacgggggggacctatttgacagggttgtagagggcggggctataccggag
ccggcctccgtcttcatctgcaggcagatactctacgctcttggatacctgcatgagaac
aatgtctgccatcgggacctgaagccagaaaacatcctcttcctctcctccctccctggt
gcacccggctacgacattgtcaagatcaccgacttcggcttgagcacagacaaggcggtg
ggatacacggataccatgtcaacagtgtgcggaactccagactacacagctcctgagctg
ctggcagctgctggcacgtcaatggaggggaggatgctatactcctgcaaggtggacatc
tggtcggtgggggcgattttgtacatgatgctgggagggaaagctcctttcaagttcacg
gacagcaacacgactgtcgtgctacagaagattttaacgggagaatattcgttccctgac
aagtactgggagaatgtctcggataatgcgatcatttctgttcgcgccatgatgcaggtg
gacccgcgcatgcgtccgacagcatcggagtgcctggagcttgactggttcgaggaggat
gaagaaagaaggatgcaaagccttggcttgcacgcggagacgacctccagaaagacagtt
ccagaccctcatgcgagattcgtcctagccaactcgctccacaagccgcccaaatga

DBGET integrated database retrieval system