KEGG   Guillardia theta: GUITHDRAFT_159138Help
Entry
GUITHDRAFT_159138 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
gtt  Guillardia theta
Pathway
gtt00020  Citrate cycle (TCA cycle)
gtt00190  Oxidative phosphorylation
gtt01100  Metabolic pathways
gtt01110  Biosynthesis of secondary metabolites
gtt01130  Biosynthesis of antibiotics
gtt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GUITHDRAFT_159138
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GUITHDRAFT_159138
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GUITHDRAFT_159138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 17311315
NCBI-ProteinID: XP_005841533
JGI: Guith1_159138
UniProt: L1K2F3
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MLRRVSQRLGNHARQYHIVDHTYDAVVVGAGGAGLRAAVGFAENGFNVACITKLFPTRSH
TVAAQGGINAALGNMTEDDWRWHFYDTVKGSDWLGDQDAIEYMCKEAPRAVIELEAYGMP
FSRTDEGKIYQRAFGGQSLKFGKGGQAYRCAAVADRTGHSMLHTLYGQALRYNTMFFVEY
FALDLIMDDDGSCRGVLALCMEDGTLHRFRAHNTVLATGGYGRAWFSATSAHTCTGDGNA
MATRAGLPLQDLEFVQFHPTGIYGAGCLMTEGCRGEGGILRNKDGERFMERYAPTAKDLA
SRDVVSRSMTIEIREGRGCGPNGEWIHLHLDHLPPEVLHERLPGISETASIFAGVDVTKQ
PIPVCPTVHYNMGGIPTNQYGQVVTKKGNDNSSIVPGLYAAGECGCASVHGANRLGANSL
LDIVVFGRAAALHVSENSKPGEKHKPLPANAGEQSIANLDKLRYSNGSLKTAECRLGLQK
TMQRDAAVFRTQTSLENGVKAVTEHYKQFQDVKITDRSLIWNTDLIETLELQNILDNAMI
TMYGAEARKESRGAHAREDFPERDDTNWMKHTVGWIDSKGKVTLDYRPVGTTVREPDNSP
VPPAKRVY
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgccgcgtcagtcagcgtcttggcaatcacgcacggcagtatcacatcgtggat
cacacctatgatgctgtcgtcgtcggtgctggaggtgctggtcttcgtgcagctgtgggc
tttgctgagaatggtttcaacgtcgcttgcatcaccaagcttttccccactcgttcgcac
actgttgctgcacagggtggtatcaatgcagctctcgggaacatgaccgaggatgattgg
agatggcatttctacgacacggtcaagggctctgactggcttggtgatcaggacgcgatt
gagtacatgtgcaaggaagcccctcgtgcagtgatagaattggaagcttacggcatgccc
ttctcaaggacagacgagggaaagatctatcagcgcgcatttggtgggcagtccctcaag
tttggcaagggaggacaagcgtaccgctgtgctgcagttgctgaccgaactgggcactcc
atgctccacactttgtatggacaggcgctgagatataacacgatgttcttcgttgaatac
tttgcgctcgacctcatcatggatgatgatggaagctgccgtggcgtacttgctctttgc
atggaggatggaactcttcatcgattcagagctcacaacaccgttcttgctaccggcggc
tacggcagagcatggttctctgccacatcagcccatacttgcactggtgatggcaatgct
atggcgactcgtgctggtctccctcttcaggatcttgaatttgtgcaattccatcccacg
ggcatttatggtgctggttgtttgatgactgaaggttgccgtggtgagggtggaatcctt
cgtaataaggacggcgaaaggttcatggagaggtatgcgccaactgccaaggatttggcc
tcaagggacgttgtctcgaggtccatgaccatcgagattcgtgaaggtcgcggctgcggt
cctaacggagagtggattcacctgcatcttgatcatcttcctccagaggtgcttcatgag
agattgcctggcatttcggagactgcctccatttttgcgggcgtggacgttaccaagcaa
cctattcctgtttgtcccaccgttcattacaacatgggcggtatcccaacgaaccagtat
ggccaagtcgtcacgaagaagggcaacgataactcttccattgttcctggtctatatgct
gcgggagagtgtggctgtgcgtccgtccacggagcaaaccgcttgggagccaactccctt
cttgacatcgtggtgttcggccgtgctgctgcgctccacgtcagtgagaatagcaagccg
ggagagaaacataagccccttcctgcaaatgccggagagcagtcgattgcaaacctggac
aagttgcgctattcgaatggctctttgaagacagcggagtgcagattaggccttcagaag
actatgcagcgtgatgctgctgttttcagaactcagacctctctggaaaacggagtcaag
gctgtcactgagcattacaaacagttccaagatgtcaagatcaccgaccgcagcttgatc
tggaatactgacctgatcgaaactttggagttgcagaacatcctggacaatgcaatgatc
accatgtatggtgcggaggcaagaaaggaatctcgcggagctcatgccagggaggacttc
cctgagcgtgatgacacaaactggatgaagcatactgtaggatggattgacagcaaggga
aaggtaactctcgactacagacctgtaggtacaactgtgcgcgagcctgacaattctcct
gttccccctgccaagcgtgtttactag

DBGET integrated database retrieval system