KEGG   Guillardia theta: GUITHDRAFT_66627Help
Entry
GUITHDRAFT_66627  CDS       T02925                                 

Gene name
Rev3
Definition
(RefSeq) Rev3 DNA polymerase zeta
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gtt03400]
    GUITHDRAFT_66627 (Rev3)
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GUITHDRAFT_66627 (Rev3)
DNA repair and recombination proteins [BR:gtt03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    GUITHDRAFT_66627 (Rev3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B zf-C4pol DUF2946
Motif
Other DBs
NCBI-GeneID: 17307391
NCBI-ProteinID: XP_005837845
JGI: Guith1_66627
UniProt: L1JRR7
LinkDB All DBs
Position
Unknown
AA seq 736 aa AA seqDB search
LRDTDPDILVGFEVQHASCGYLLERSAAIGFPLDRCLSRCPFHRSTLESRPDTYGQQQQS
GIHVCGREILNVWRLCRQEIKLGLYNYTNVCAKVLNKRVPSFPPQLLHSWFQHLASPHSL
KRQVLLYLLEKASNTLLILEAMELVGRTCELARVFGIDFFSVLSRGSQYRVESMLYRLAR
TQNFLLLSPSVQQRQSQPATECIPLVMEPQSAFYSSPVCVLDFRSLYPSVVIAYNMCYST
CLGKLVEPDSDGNVKLGVSSLRRAPGLLASVREEAIITPNGMAFLPPDKREGVLPRLLRE
ILQARVAVKKLMKQVGGDVKLYRTLNSRQFGLKLIANVTYGYTSAGFSGRMPCADLADAI
VQTGRETLERAIRTVEEGRQWGARVIYGDTDSLFVEIPGRSREEAFRIGREIAAAVTAEN
PAPMELELEKVYQPSMMVAKKRYVGYSYDSPSSKPVLDAKGIEMVRRDSCPLVMRVQEKA
LKVLFETKNISKLKSYMEGVFMDIIASNLNINEYVFAKEVRQGTYASSTLPPAATVNATK
VLRDPRAGALHAERIPYVVVCGQPGARLVDLVLDPRELLASSGMLRINAQYYITKALIPC
LERLLSLFGVDIRRWYLELPRYSRASSRDHASHEGSIRSHFQSMHCILCDQLSRTAVCAE
CTSLPQVALCTMQNRRGRVERDLARLCRICVSCVGSMRLVTGCDAVDCPVLYDRVKAQQL
WEASSRIDWGVNFLEW
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
ctgcgggatactgaccccgacatcctcgtcggcttcgaagttcagcacgcgtcctgcggt
tacctcctcgagcgatcagccgctatcgggttcccccttgaccgctgcctctcccgctgt
cccttccaccgcagcactctagagtctcgacccgacacctacggccagcagcagcagtca
ggcatccacgtctgcgggagggagattctcaacgtgtggcgattatgccggcaggagatc
aaacttggtctgtacaactacaccaacgtctgcgctaaggtgctgaacaagagggtgcca
tcctttcctcctcagctgctccattcatggttccagcaccttgcctccccgcacagtctg
aagcggcaggtcctgctctacctccttgagaaggccagcaacacgctcctcatcctcgaa
gccatggagctcgtcggcaggacctgcgaacttgcgcgcgtcttcggcatcgacttcttc
tcggtcctcagccgcgggtcccagtatcgggtagagagcatgctctaccgcctcgctcgc
acgcagaacttcctcctcctctctccctccgtgcagcagcggcagagccagccagccacg
gagtgcatcccgctggtgatggagccgcagagcgccttctacagcagccccgtctgcgtc
ctcgacttccggtccctctacccctctgtcgtgatcgcctacaacatgtgttactccacc
tgcctcggcaagctcgtcgagcccgacagcgacggcaacgtcaagctcggcgtctccagc
ctccgccgcgcccccggcctgctggcgagcgtgcgagaggaggcgatcatcactcccaat
ggcatggcgttcctgccgcccgacaagcgcgagggggtgctgcctcgtctgctgcgagag
atcctgcaggcgagagtggcggtgaagaagttgatgaaacaggtcgggggagacgtgaag
ctctacaggaccctcaactccaggcagttcggcctcaagctcatcgccaacgtcacctac
ggctacacctccgccggcttctccggccgcatgccatgcgccgacttggccgacgccatc
gtgcagacggggcgagagacgctggagcgagcgatccggacggtagaagaggggaggcaa
tggggggcgcgagtgatctacggggacacagacagtctcttcgtcgagatccctgggagg
tcgcgagaggaagcgtttcgcatcggcagggagatcgctgctgcggtcacagctgagaac
cctgctccgatggagctggagctggagaaagtctatcagccgagcatgatggtggccaag
aagcgctacgtggggtacagctacgactctccttcctccaagcctgtcctcgacgccaag
ggcatcgagatggtgaggagagactcgtgtccgctggtcatgagggtgcaggagaaggcg
ctgaaggtgctgttcgagacgaagaacatctccaagctcaagagctacatggagggcgtc
ttcatggacatcatcgcctccaacttgaacatcaacgagtacgtctttgcgaaggaggtc
aggcaggggacctacgcctcttccaccctcccccctgccgccactgtcaacgcaaccaag
gttctccgagacccccgagcgggagctctgcatgccgagaggatcccctacgtcgtcgtg
tgcggccagccaggagcgcgtctggtggacctcgtccttgacccgcgcgagctcctcgcc
tcctctgggatgcttcggatcaacgcgcagtactacatcaccaaggctctgatcccctgc
ctcgagcgcctcctctccctctttggtgtcgacatacggcgatggtacctcgagctccca
cgctacagccgcgcaagctcgagggaccacgcttctcatgaaggcagcatccggagtcac
ttccagagcatgcactgtatcctctgcgaccagctctccaggacggccgtctgtgcggag
tgcacttcccttcctcaagtggctctgtgtacgatgcagaatcgtcgggggagggtggag
cgagatcttgcccggctctgcaggatctgcgtgagttgtgtagggagcatgcggctcgtg
acagggtgcgacgcggtggactgcccggtgctctacgaccgcgtgaaggcgcagcagctg
tgggaagcatcgagtcgcatagactggggcgtgaacttcttggagtggtga

DBGET integrated database retrieval system