KEGG   Guillardia theta: GUITHDRAFT_67076Help
Entry
GUITHDRAFT_67076  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GUITHDRAFT_67076
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     GUITHDRAFT_67076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 17306865
NCBI-ProteinID: XP_005837230
JGI: Guith1_67076
UniProt: L1JPY8
LinkDB All DBs
Position
Unknown
AA seq 288 aa AA seqDB search
MLRHAAARIAVGQMRSTSDVEANMAESKRLCQLARLQGASFLSLPECFEFMGTPGTGDAL
KMAEPLTGEIVSRYRKLARDEGLWLSLGGFHERKTKDDPKIYNTHIVVDDAGQIAATYRK
LHLFDVDYDGGFQESRSTHKGEEIVVLKDTPFGNIGITTCYDLRFPELFVALRDAGAHLI
LIPSAFMPTTGEAHWEAGGSLRGEECDRCRQVLLRARAIETQCYVAAAAQFGRHNEKRSS
YGHALIVDPWGKVLQDAGSESAGVVVADLDFSLLEQVRARMPMSAHRR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgacatgcagcagctcggatcgcggtcggtcagatgcgatcgacgagtgacgtg
gaggcgaacatggcagagagcaagaggctgtgccaacttgctcgcttgcagggcgcctcc
ttcttgtcgctccctgagtgcttcgagttcatgggaaccccaggcacgggcgacgcgttg
aagatggcagagcctttgacgggagaaatcgtctctcggtacagaaagctggcgcgagac
gagggtttgtggctgagcttaggaggcttccacgaacgcaagacaaaagacgatccaaag
atatacaacactcacatcgttgtagacgatgctgggcagatcgcagccacataccggaag
ctgcacttgttcgatgtggattatgatggagggttccaggagagcagatcaacgcataaa
ggagaggaaatcgttgtgcttaaagacactccgtttggcaacatcgggatcacaacatgc
tacgatctcaggtttcctgagctcttcgtcgcactcagagatgcaggagcacatctcatc
ctgatccccagcgccttcatgccgaccacgggcgaggcgcactgggaggcaggaggaagc
ctgagaggggaggagtgtgatagatgccggcaggtgctgctgcgagcaagagcgatcgag
acccagtgctatgtcgcagccgcagcacagttcggaagacacaatgagaagcggtcgagc
tacggccatgcgctcatcgtcgacccgtgggggaaggtgcttcaagacgcaggttccgaa
tctgctggcgttgtcgttgccgacttggacttctccctccttgaacaggttcgtgctcgc
atgccgatgtcagctcatcgaaggtaa

DBGET integrated database retrieval system