KEGG   Guillardia theta: GUITHDRAFT_73636Help
Entry
GUITHDRAFT_73636  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_C_6 GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 17299482
NCBI-ProteinID: XP_005829875
JGI: Guith1_73636
UniProt: L1J482
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
IPGLRDDKVELFESGAILLYLSDKYGESNTPEKRADAAKWIVWANAELDGVLFTRDIEVA
RAPKVLMQLDAILNGKEFLVGNQFSVADVAVASYLLFIPLFHPNFDASRFPNVLQYMDRC
ASRPAFQKTMGTNALQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
attcctggcttgcgtgacgataaggttgagctgtttgagagcggcgccatcttgctgtac
ctgtcggacaagtacggggagagcaatacccccgagaagcgagcagacgccgcaaagtgg
atcgtgtgggccaatgcggagctggatggagttttgttcacccgggatattgaggttgct
cgggctcccaaggtgctgatgcagctggatgcaatcctcaacgggaaggagttcctcgtt
ggcaaccagttctccgtggcggacgtggcagtcgcctcctacctccttttcatccccctg
ttccaccccaacttcgatgccagccgcttcccaaatgtccttcagtacatggacaggtgc
gcctcccgtcctgcattccagaagaccatgggaaccaacgccctccagtga

DBGET integrated database retrieval system