KEGG   Guillardia theta: GUITHDRAFT_73809Help
Entry
GUITHDRAFT_73809  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gtt  Guillardia theta
Pathway
gtt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GUITHDRAFT_73809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gtt02000]
    GUITHDRAFT_73809
Enzymes [BR:gtt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GUITHDRAFT_73809
Transporters [BR:gtt02000]
 Other Transporters
  Pores ion channels [TC:1]
   GUITHDRAFT_73809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C GST_N GST_C_5 GST_N_4 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 17299115
NCBI-ProteinID: XP_005829430
JGI: Guith1_73809
UniProt: L1J2Y2
LinkDB All DBs
Position
Unknown
AA seq 408 aa AA seqDB search
ASGRGPANHQASVRLFEASDDTEPRVILYRDKAAWCPYCEKVWLHLEEKRVPYRVEKVNM
RCYGDKPDWFMRMQPSGGIPVAKIDGQVITESNDIMQTLEDVFPQNPMLPASSDPQAPRV
GKLLRLERQIFSSWFRWLVSPSRFGDSQQINFESLLSQVDEELKEANDIAVANGHKEGRF
FLGDRISLVDFMFAPFLERMAASVPYYKGLVIRDPARWPHVELWFKAMEERDSFKGIQSD
YYTHCHDLPPQIGNCFSHPEAEKYRKEIDGELWRLPVRQGIEPLNAGADMARREAAARVI
ENRDKLVPFCLRAVGARGSPRVSAPLSDPNAKPDLRFTQQQMDAALRHLVDAMLMEAADF
SRLSPGLPSSSIKKGLTYLRDRVSVPRDMSFAAAQQLRAHLNELANAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gcgagcggacgaggaccagcaaaccatcaggcgagtgttcgtctgttcgaggcctcggac
gacacggagcctcgggtgatcctgtatcgagacaaggcagcctggtgtccgtactgcgag
aaggtatggcttcatctagaggagaagagagtaccgtatcgtgtggagaaggtcaacatg
agatgctacggtgacaagcccgactggttcatgaggatgcagccgagcggagggattcct
gtagccaagatcgacgggcaggtgatcaccgagtcaaacgacatcatgcagactctcgaa
gacgtctttcctcagaaccccatgctccctgccagctccgacccgcaggcccctcgagtt
gggaagctgctgaggctagagcgacagatctttagctcctggttccgctggttggtctct
ccgtctcgctttggagactcgcagcagatcaatttcgagtctctcctctcccaagtcgac
gaggagctcaaggaagctaatgacatcgctgtggctaacgggcataaagagggacgcttc
ttccttggagacaggatcagtttggtcgatttcatgttcgctcccttcctggagcgcatg
gcggcgtcagttccctactacaaggggctggttatccgtgaccctgcgcgctggccacac
gtagagctgtggttcaaagccatggaggagcgggactcgttcaaggggattcagagcgac
tactacacgcactgtcatgatcttcctcctcagatcggaaactgcttctctcaccctgag
gctgagaagtaccgcaaggagatcgacggtgagctctggcgcctgccagtcagacagggc
atcgagcccttgaacgcaggagctgacatggcgcgacgagaggctgcggcgcgagtgatt
gagaacagagacaaacttgttcccttctgcctgcgagccgtgggagctaggggctcacct
cgcgtgtctgctccgctctcagaccccaacgccaagcccgatctgaggttcacccagcag
cagatggacgcggcgctcaggcatctggtggacgccatgctcatggaggctgctgacttc
tctcgactgtccccaggcttgcccagcagctccatcaagaaggggctcacgtatcttcgt
gaccgtgtttccgttccccgggatatgtcgtttgctgctgctcagcagctacgcgcacac
ttgaacgagctggcgaacgcgctctga

DBGET integrated database retrieval system