KEGG   Guillardia theta: GUITHDRAFT_84236
Entry
GUITHDRAFT_84236  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
gtt  Guillardia theta
Pathway
gtt00620  Pyruvate metabolism
gtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GUITHDRAFT_84236
Enzymes [BR:gtt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     GUITHDRAFT_84236
SSDB
Other DBs
NCBI-GeneID: 17310500
NCBI-ProteinID: XP_005840597
JGI: Guith1_84236
UniProt: L1JZ10
LinkDB
Position
Unknown
AA seq 1177 aa
MTAYVNLKLAACGSAPVESSSKEEGFLRLVEPILKAYQEQQHVLINQGRSLCPADQRIQD
WLDDFLSDVGGSPRLPVRQLKLDRHGLTRILSLPKGEDIYQNEYITSYRLAQGVVHNPKS
DKRTTKGVFHVVEGGLPISGDKKAVPKKTFKAILESALRPPEELMVVPYTANQPNKTKIF
ASLLLRPLACPEVQGFIEEKSHEVRFIVPASMVANLDFVESIFGNGDNPDLAENDAALDP
EHWTGTTGLVVLVPHLTKLKAKDVHLPHKSQATPRQIQDGMFWEKEDDLYNGGNAFKLTA
RDARGVVVTLIADNYFGYCKKEVKTQLGYAANLYGQLEEEHSGQESLGNAAYLGETHKYL
IETATKRTFQDVTKLLKDAVEVQPEGYAIDKDYPDIYYIPENAIFSMIKQSITWTSNGKE
QTINLKPRTTYVLPSGYKVEMVKKGSQNVVKGKRGGKSGPYEKWHLRGTTAEGANLHKPA
TVSGGGKSEISKRLEDMIKYGPVFTNHVSEDFDALQSIFSKDYSAIMKPGNEKLHPFDHI
GVAPSAIKTLLDPRVSLGTIIKLLSYSPHYTAEHLEFINGIPSYLRELLQVVKQNYKAEW
GSNWRVHFNADAVNGELGHEVKYKGDPLLSAVIRVGFRSNVAWKTFTLRQDFFPCEKLQT
EDDITASVVVPSSSLKGMNFRLKKPSYKFSQNCEFRLFQRPDEAIHRGYDKITELDMSKP
GNFISNFEPLDKAAVQKIVDETIGFEKFTEPMQDRLLSFLDSSSSYVVSSAHPRIVDGKP
TKNPRYLQDSMEITDQRAFHLCSVATRLARGIPMGEAVHTPVNSVLCGRRNNPPEGSIPA
LAVHNPIHYYELPELFMELASSMTGKSPSTTGAGSEGALTKGPFNMLNQIHDLNAALLAY
ALTETHVFISSAGVIGPQKQVDHDISLLVPEVWSRMREEERDANWLIKNGYLEKIPDMNL
NGEKVPSSVLGYRITKSFVQQFFGRVFADPASVFSEDMLKPELQDEKIYADGIRTITVTN
KRVAEMYLADGGVDMAVPPLKALLHIMAKGEYEGMTLESPEFRKLFTRESILSSPWYQER
IKCFQQREAERLQRGIQYLENFVAGPSNSKEDDWKGKQICDELKLNERIEHVKAQLAYVQ
SAEYLKKLEGTIGVDPALFDTARGSNFDRKLPIAGSH
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgaccgcttacgtgaacttgaagcttgccgcctgtggctctgctcccgttgaatcgtcc
tctaaggaagaagggttcctgaggcttgtagaacccattttgaaagcgtatcaagagcag
cagcacgtactcatcaaccaagggaggtccttgtgcccagccgatcagcgtattcaagac
tggctggatgacttcctgtctgacgtaggtggctcgccaagactgcctgtcagacagctt
aaactggatcgccatggcttgactcgtattctctcattgccaaagggggaggatatctac
cagaacgagtacatcacttcatacagacttgcacaaggagttgttcacaatcccaagagc
gacaagcgaacgaccaaaggtgttttccatgttgtcgagggtggactccctatttcgggt
gacaaaaaggccgtaccaaagaaaactttcaaggccattctagaaagtgctttgaggcct
cctgaggaactcatggtggtcccgtatacagccaatcaaccaaacaagacgaagatcttt
gcctcattgctactccgtcctcttgcctgccccgaggtacaaggcttcattgaagagaaa
tctcacgaggtgcgcttcattgttccagcaagtatggttgccaacctcgatttcgtggag
tcaattttcggcaatggagacaaccctgatcttgctgagaacgacgcggcattggatcct
gagcactggactggcacaacaggtttggttgtgctcgtgccacatctcacaaagttgaaa
gccaaagatgttcatctcccgcataaatcacaggctacaccgcgacaaattcaggatggt
atgttctgggagaaagaggatgatctctacaatggaggaaatgctttcaagttgactgct
cgtgatgcacgaggagttgtcgttacgctgattgccgacaactacttcggttactgcaag
aaagaagtcaagacacagttaggatacgctgcgaatttgtacggccagttggaagaagaa
cactctggtcaggaatctttgggcaatgcagcgtacctcggcgagacgcacaagtatttg
attgaaactgcaaccaagaggaccttccaagacgtaaccaagctgttgaaggatgctgtc
gaagttcagcccgaaggatatgccatcgacaaggattaccccgatatctactacattcca
gagaatgctattttcagcatgatcaagcaaagcatcacatggacttccaatggaaaggag
cagactatcaatttgaagccaaggaccacctacgttcttccgagcggatacaaagttgag
atggtgaagaagggatctcaaaacgttgtgaagggaaagagaggtggaaaatcaggaccc
tacgaaaaatggcacctaaggggaacaactgctgaaggagcaaaccttcacaaacctgca
acagtttctggcggaggaaagtcagagatcagcaagagattggaagacatgattaaatat
ggtcctgtattcacaaatcatgtgtctgaggacttcgatgctctccaatcgattttcagc
aaggactactctgctatcatgaagcctggcaatgaaaaattgcacccttttgatcacatt
ggtgttgctccaagtgccatcaagacccttctggaccctcgtgtgtctcttggaaccatc
atcaaactcttgtcatattctcctcactacaccgcagagcatttggagttcatcaacgga
attccatcgtatctcagagagcttcttcaagttgtgaaacagaactacaaagccgaatgg
ggttccaattggcgagtacatttcaatgcagatgctgtcaatggcgagcttggccacgag
gtcaagtacaaaggcgatccactactttctgcagtcatccgtgttggcttccgttctaat
gttgcctggaagacgtttactttgaggcaggacttctttccatgtgaaaagctgcagaca
gaagacgacatcaccgcatctgttgtcgttccttcctcatctctaaagggcatgaacttc
aggctgaagaagccctcctacaagttttcacagaactgcgaattccgcttgtttcagagg
ccagatgaagccattcacagaggttatgataaaatcacggagctagatatgtccaagcct
ggaaacttcatttccaactttgagccgcttgacaaggcagctgtacagaagattgtcgat
gaaaccattggattcgagaaattcacagagcccatgcaggatagacttctgtccttcctc
gattcctcttcctcgtatgttgtatcttctgcccatcctcgtattgtggatggaaaacca
accaagaatcccagatatttgcaagattctatggagatcacggatcagcgcgcattccac
ctctgcagcgtggccaccaggttggccagaggaattccgatgggagaggcggtccatact
cctgtgaactctgtcctctgcggacgtcgaaataatccccctgagggctcaattccagcg
ctcgccgttcacaatcccatccactactatgagttgccagagttgttcatggagctcgct
tcgtccatgactggaaagtcgccttccaccacaggagctggatctgagggagctttgacc
aagggccccttcaacatgctcaaccagattcatgacctcaatgctgcattattggcatat
gctttgactgaaactcacgttttcatttcctctgctggagtgattggtccccagaagcag
gttgaccatgacatctcgctcttggttccagaggtttggagtcgcatgagggaagaggag
cgtgacgctaattggctcatcaagaatgggtatcttgagaagatccctgacatgaacctc
aatggtgagaaggttccgtcctcggtcttgggttatcgtatcaccaagtcgtttgtccag
cagttctttggccgtgtgtttgctgatccagcctctgtcttcagtgaggacatgttgaag
ccagaattgcaggatgagaaaatctatgcggatggtatcagaaccatcactgtcacgaac
aagcgcgttgctgagatgtacttggctgacggtggtgtcgacatggcagtgccccctctc
aaggcgcttttgcacatcatggctaagggcgagtacgaaggaatgaccctggagagccct
gagttcagaaagctcttcaccagagagtccatcttgtcctcgccttggtaccaggagagg
atcaagtgcttccagcaacgtgaagccgagagactgcagaggggcatccagtatctcgag
aacttcgtggctggaccatccaacagcaaggaggacgactggaagggcaagcagatctgc
gatgagctgaagctcaacgagaggatcgagcacgtcaaggcccagctcgcgtatgtacag
tcggccgagtatctcaagaagctcgaaggaaccatcggagtggacccagcgctctttgac
actgctcggggatccaacttcgaccgtaagcttcctattgctggctcgcactag

DBGET integrated database retrieval system