KEGG   Guillardia theta: GUITHDRAFT_94767Help
Entry
GUITHDRAFT_94767  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_C_2 GST_C_3 GST_N_2 GST_N_3 CcmH GST_C_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 17301839
NCBI-ProteinID: XP_005832214
JGI: Guith1_94767
UniProt: L1JAW1
LinkDB All DBs
Position
Unknown
AA seq 252 aa AA seqDB search
MGKMNRPVAGARFDKPLPRGEHPLQLYSLGTPNGHKVTILLEELGIEYDAWKINIMQLDQ
FGSEFTKINPNSKIPALLDYSENPPIRVFESGSILMYIADKYGKFFPKELRPRTECLNWL
MWQMGTAPFIGGGFGHFYKYAPIKIEYAIDRYSMETKRQLDLLDKHLAENKYICGEEYTI
ADMAIFPWIRAIPVFYGATEFLQFPSYKHLNAWMERVGERPAVKRGLKVNGFTDKDLAER
HSAADFDKLPKE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatgaataggcctgttgctggagcgaggtttgacaagcctcttccacgtggc
gagcatcctcttcagctctacagcttgggaacaccaaatggacacaaggtcacgatcctc
ctggaggagcttggcatcgagtacgatgcctggaagatcaacatcatgcagctcgatcag
tttggatctgagttcaccaagatcaatcccaactccaagatccctgccttgctcgactac
agcgagaacccacccatccgcgtgttcgagtcgggatcgattttgatgtacatcgcggac
aagtacggcaagttcttccccaaggagcttcgtcctaggactgagtgcctcaactggttg
atgtggcagatgggaacggcacccttcatcggcggtgggtttggccatttctacaagtac
gcccctatcaagattgagtacgccatcgaccgttacagcatggagactaagcgccagctc
gatttgctcgacaagcacttggccgagaacaagtacatctgtggtgaggagtacaccatc
gccgatatggcaatcttcccctggatccgtgccatccctgtcttctatggggctacagag
ttccttcaattcccttcatacaagcacctcaacgcatggatggagagagttggagagcgc
ccggccgtcaagcgcggcctgaaggtcaatggcttcactgacaaggatcttgccgagcgc
cactcagcagccgactttgacaagctccccaaggagtga

DBGET integrated database retrieval system