KEGG   Geobacter uraniireducens: Gura_0534Help
Entry
Gura_0534         CDS       T00521                                 

Definition
(GenBank) hypothetical protein
Organism
gur  Geobacter uraniireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 AP3D1 Cytochrom_C Rib_recp_KP_reg Phage_Gp23 DUF4199 Med19 Rxt3 ETRAMP DUF4887 SHR3_chaperone Connexin TMEM208_SND2 SARG
Motif
Other DBs
NCBI-ProteinID: ABQ24748
UniProt: A5GCE4
LinkDB All DBs
Position
complement(625517..626065)
Genome map
AA seq 182 aa AA seqDB search
MTKTMKMAVLFLALAFAQATVIPSGYADDNYATKIQKVLKEKKEKEEKEKKEKEEKEKKE
KKERERRRTPRPTPAPVPAPAPKPTPAPAPAPAPKPAPTPAPAPAPAPAPAPAPAPAPAP
APAPAPALDGAALYAQYCAGCHGQGKRGKSASATQSAINNNIGGMGSLKSLTAAQITAIS
QY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacgatgaaaatggcggtattatttctggctctggcattcgcacaagcaacg
gtaatcccttccggctatgcagacgacaactacgcaaccaaaatacagaaagtgctgaag
gagaagaaggagaaggaagagaaagagaagaaggagaaggaagagaaggagaagaaggag
aagaaggagagggagcgccgcagaacccctaggccgactcctgcgccagtaccggctccg
gccccgaaaccgactccggcacctgctccggctccggctccgaaacctgctccgactcca
gcacctgctccagcacctgctccagcaccagctccagcaccagctccagctccggcacca
gctccggcaccagctccggctcttgacggcgccgcactctacgcccagtactgcgccggg
tgtcacggccagggaaaacgcggcaagtccgcttctgcgacccagagcgccatcaacaac
aacataggcggcatgggctccctcaaatccctgacagctgcccaaatcaccgccatttcc
cagtactga

DBGET integrated database retrieval system