KEGG   Geobacter uraniireducens: Gura_1703Help
Entry
Gura_1703         CDS       T00521                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00030  Pentose phosphate pathway
gur00051  Fructose and mannose metabolism
gur00052  Galactose metabolism
gur00680  Methane metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
gur01230  Biosynthesis of amino acids
gur03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:gur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_1703
   00030 Pentose phosphate pathway
    Gura_1703
   00051 Fructose and mannose metabolism
    Gura_1703
   00052 Galactose metabolism
    Gura_1703
  09102 Energy metabolism
   00680 Methane metabolism
    Gura_1703
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Gura_1703
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gur01009]
    Gura_1703
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gur03019]
    Gura_1703
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gura_1703
Protein phosphatases and associated proteins [BR:gur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gura_1703
Messenger RNA biogenesis [BR:gur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gura_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABQ25898
UniProt: A5GEP3
LinkDB All DBs
Position
complement(1974820..1975779)
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNATIRSAVRTGLRMNIEMVGFRKGYLGLMKGDGITLDSKSVSGI
LHRGGTFLQSARSQEFRTPEGQQKALDNLRNLGVEGLVILGGDGSLTGALALHRLGFPVI
GIPASIDNDIPFTDMALGVDTALNNIIYAVDCIKDTASSHARAFVIEVMGRNSGYLASVS
AIATGAEFALVPEREFDLSEICQQLRARYEEGRDNAIIILAEGAGNAQHIADSIKDAIGF
ETRVTVLGHYQRGGAPTVFDRLLASRLGKKAVELLISGQQGLMVGLSCNAIIATPLEDVI
KGEKRPQDEMLRLAEVLGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcggcatattgaccagcggcggcgactgctccggcatgaacgccaccatt
cgcagcgcggtacgcacgggactccggatgaacattgaaatggtcggttttcgcaagggc
tacctggggctcatgaaaggtgacggcatcaccctcgactccaagtcggtttccggcatc
ctccaccgggggggcaccttcctccagtcggcccgctcacaggaattccgcaccccggaa
ggacagcaaaaggccctcgacaacctgcgaaacctcggtgtcgaggggctcgtcatcctc
ggcggcgacggatcgctgaccggggcgctcgccctccaccgcctcggtttcccggtcata
ggcattcccgccagcatcgacaacgacatccccttcacggacatggcgctgggggtcgat
actgcactcaacaacatcatctatgctgtggactgcatcaaagacaccgcaagctcacat
gcccgcgccttcgtaatcgaggtgatggggcgcaactccggctacctggcaagcgtcagc
gccatcgccaccggcgccgaattcgccctggtgccggaacgggagttcgacctctccgag
atctgccagcagctcagagcccgctacgaagaggggcgggacaacgccataatcatcctc
gccgaaggggcgggcaacgcccagcatattgccgacagcatcaaggatgccatcggcttc
gagacgagggttacggtgctcggccattaccagcgcggcggcgcaccgactgtctttgac
cggctcctggcaagccgcctcggcaaaaaagcggtcgagctcctcatatcggggcagcaa
gggctgatggtcggcctctcgtgcaacgccatcattgcaacccccctcgaagacgtaatc
aaaggcgaaaagcgcccacaagacgagatgctgcgactagcggaggtattggggatttaa

DBGET integrated database retrieval system