KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0002Help
Entry
HMPREF0424_0002   CDS       T01146                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gva  Gardnerella vaginalis 409-05
Brite
KEGG Orthology (KO) [BR:gva00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0424_0002 (ahpF)
Enzymes [BR:gva01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF0424_0002 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Thi4 Glutaredoxin AlaDh_PNT_C K_oxygenase Trp_halogenase NAD_binding_7 PEP_hydrolase FMO-like HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADB14675
UniProt: D2RCJ9
LinkDB All DBs
Position
complement(956..2629)
Genome map
AA seq 557 aa AA seqDB search
MSLLNASLTAQLSELLKKMVSKIEIISYVDNSETSQKVKSLLEEVSQQSDKISISEVNNN
EISNVKRKPSFELRRKLDNPVNGESTVSVSFAGLPLGHEFSSLVLALLQVSGYAPKISDE
QRDAILKLGSHNVTTYMSVTCLNCPEVVQSLNTISVINPKIQHTVVEGSAFREEVDKLGV
MSVPAVFENGKLVSSGRAGIDELVSVLASQEKSVEQNENGNNGNSVSSANVALAEKMNSQ
NPYDIVIAGGGPAASAAAIYTARKGLRTAMIMDHRGGQVVETESIENHISQTHTTGSQLA
ADLTKHISQYDIDVFTPDWADSLDLSKEPYGLHTIHARSGGSLKARAVIIATGATWRTLG
VPGEDEYRNRGVSFCPHCDGPLFKDKNVVVVGGGNSGVEAAIDLAGVAKHVTVVEFMDVL
KADQVLLNTLHKLPNAEVITSAAVSSIEGNGSKVTAIRYIDRNKADDDENREHIVETDGV
FVQIGLAPNTRWLVNNISLNNRGEIITNRAGCTDTPGVFAAGDCSDEPYKQIVTAYGSGA
NAALSAFDYLIRSPQNK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgttgaatgcatcattaactgctcagctttcagaattactaaaaaagatggta
tctaaaatagaaatcatttcttacgttgataattctgaaacatctcaaaaagttaaatcc
ttactggaagaagtatctcagcaaagtgacaaaatcagtatttctgaagtaaataataat
gaaattagcaatgtaaagcgtaaaccaagctttgaattgcgtagaaaactagataatcca
gtaaatggagaatctactgtatcggttagttttgcgggattgcctttagggcacgaattc
agctctttagtactagcacttctacaagtaagcggctatgcgccaaaaattagtgatgag
caacgcgatgcaatactaaagcttggttcacacaatgtgacaacatacatgtcggtaact
tgcctgaattgcccagaagttgtgcaatcgcttaataccatttctgttattaaccctaaa
attcagcatactgtagttgaaggtagcgctttccgtgaagaagtagataaactcggtgta
atgagcgtgccagcagtttttgaaaatggcaaacttgtttcctccggacgggcaggaatt
gacgaacttgtatctgtgcttgcatcacaagaaaaatctgttgagcaaaatgagaatggc
aataatggtaatagcgtttcttcggcaaatgttgcgctcgcagaaaaaatgaattcgcaa
aatccatacgatattgttattgctggcggcggtcctgctgcttctgctgccgcaatttac
actgctcgtaagggtttgcgtacggctatgattatggatcatcgtggcggacaggttgta
gaaactgaaagtattgaaaatcatatttcccaaacgcatacgactggttctcaactagca
gcagatttaactaagcatatttctcaatacgatattgacgtatttactcctgattgggca
gactcgctcgatttatctaaggaaccatatgggttacatactattcatgcgcgttctggc
ggatctttgaaagcgcgtgcagtgattattgcaactggcgcgacttggcgtacgttgggc
gttcctggagaagatgagtataggaatagaggcgtatcattctgccctcattgcgacggc
ccacttttcaaagataagaatgttgtcgttgttggcggcggaaattctggtgttgaagct
gctattgatttagcaggagttgcaaaacatgtgacggtggttgagttcatggatgtgctt
aaagctgatcaagtattgcttaatactttgcataaattacctaacgctgaagttattacg
agtgctgccgtaagtagtattgaaggtaatggtagtaaagttactgcaatacgttacata
gatcgcaataaagcagacgatgatgaaaacagagaacatattgttgaaaccgatggggtt
tttgtgcaaattggtttagctccgaatactcgttggcttgtaaataatatttctctcaat
aatcgaggagaaattattacgaatcgcgctggatgcactgatactccgggtgtttttgct
gctggagattgttcagacgaaccgtataagcagattgttacagcgtatggttctggagcc
aatgctgcgttatctgcatttgactatcttatccgcagcccgcaaaataaataa

DBGET integrated database retrieval system