KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20313Help
Entry
HMPREF0421_20313  CDS       T01344                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
gvg00473  D-Alanine metabolism
gvg00550  Peptidoglycan biosynthesis
gvg01100  Metabolic pathways
gvg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gvg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0421_20313 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0421_20313 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HMPREF0421_20313 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gvg01011]
    HMPREF0421_20313 (ddl)
Enzymes [BR:gvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HMPREF0421_20313 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:gvg01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0421_20313 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 9903858
NCBI-ProteinID: YP_003985418
UniProt: E3D8K1
LinkDB All DBs
Position
376966..378111
Genome map
AA seq 381 aa AA seqDB search
MTKKRVVFLYGGKADEHSISCISAAGVLSAVDESRFEIVRIAITKQGEWIVGGEDPRNFR
MEEGELPVITKTAETRDVVLDPAKGADGFLVREADGTLTSLGHIDAVFPVLHGPNGEDGT
LQGLLEMMQVPYVGCGVLASAACMDKYYAKQLFKAAGIDVAPGIALDVRKFASDAANHFD
AYANEILEQVEEAKLEYPLFVKPSRAGSSFGVTKVESRDAKALADAVYEASKHDWRVLVE
QGIDAREIECAVLAARDGDEPQASWPGEVVLDKREAGEDQFYDFDSKYMDSAASHVEVPA
NLPEETLQRVRNTALAAFKAADGRGLSRVDSFVTPEGHVMINEINTMPGFTPISMYPKAW
EATGISYSDLITKLIEGVILD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagcgtgtagtgttcttgtatggcggtaaagcagacgaacattcgatttct
tgcatatctgctgctggagtgctcagtgctgtagacgaaagtcgatttgaaatcgtgcgc
attgcaatcacaaagcaaggcgagtggattgttggcggcgaagatccgcgaaacttccgc
atggaagaaggagagcttccggtaataacaaaaaccgcggaaacgcgcgatgttgtacta
gaccctgcaaagggagcagatggatttttggtgcgagaggcggatggcacgcttacaagc
ttaggtcatattgacgcagttttcccagttcttcacggtccaaacggcgaagatggcact
ttgcaaggcttgctagaaatgatgcaagttccatacgttggttgcggagttttggcatcc
gccgcgtgcatggataagtattacgctaagcaactttttaaggcagcaggaattgatgtt
gctccaggaatcgcgctggatgtgcgaaagttcgctagcgacgcggcaaatcactttgat
gcgtacgcaaacgaaattcttgagcaagttgaagaagcaaaactcgagtatccgcttttt
gtaaagccaagccgagcaggatctagctttggcgtaacaaaagttgaatcgcgcgatgct
aaagctttagcagatgccgtttatgaggcttcaaagcacgattggcgagtattggtagag
cagggaattgacgcgcgcgaaatcgagtgcgctgttcttgcggcgcgcgacggcgacgag
cctcaggcaagctggcctggagaagttgtgcttgacaagcgcgaggctggagaagaccag
ttctacgattttgacagcaaatacatggattctgcagcttcacacgtggaagttccagca
aatctgccagaagaaactttgcagcgcgttcgcaatactgcgctcgcagcgttcaaagcg
gcagatggcagaggacttagtcgcgtggattcattcgttactccagaaggacatgtaatg
attaacgaaatcaacacaatgcctggatttacgccaatctccatgtatccaaaagcttgg
gaagcaaccggaataagctacagtgatttaatcacaaagcttattgaaggcgtgatttta
gactga

DBGET integrated database retrieval system