KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20839Help
Entry
HMPREF0421_20839  CDS       T01344                                 

Gene name
ndh
Definition
(RefSeq) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Brite
KEGG Orthology (KO) [BR:gvg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0421_20839 (ndh)
Enzymes [BR:gvg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF0421_20839 (ndh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 Trp_halogenase FMO-like DAO
Motif
Other DBs
NCBI-GeneID: 9904405
NCBI-ProteinID: YP_003985944
UniProt: E3DA27
LinkDB All DBs
Position
complement(1026271..1027884)
Genome map
AA seq 537 aa AA seqDB search
MSLLDSNLTTQLAGLLTKMVNPINLVAYVDSSKNSQKVIELLNEVADQSSKITVIEGDKS
RVNRKPSFAVLNPQTNVSVSFAGLPLGHEFSSLVLAILQVSGYAPKISDGQRKAILSIGS
HEVTTYMSVTCINCPEVVQSLNTISIINPKVKHIAVEGSAFKDEVDSLGVMSVPAVFENG
KMISSGRSSIDELVAILLSQEENSDSSNSKVSGDSSLAQKMNAKNPYDVILVGGGPAASA
AAIYTARKGLKTAMIMDHRGGQVVETESIENHISQTHTTGAKLANDLTNHIAQYDIDVFT
PDWATSLDIAEESYGLHTISTKSGGSLKAKAVIIATGATWRTLGIPGEDEYRNKGVSFCP
HCDGPLFKNKNVVVVGGGNSGVEAAIDLAGVANHVTLIEYMNTLKADQILVNALNNLSNT
TVIIGAALSSIEGDGTKVIAVRYKDRNANNGENSEKILHTDGVFVQIGLMPNTKWISNKL
SLNNRSEIVTDRKGCTSVHGIFAAGDCTDEPYKQIVTAYGSGANAALSAFDYLIRNV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtctttattggattcaaacttaactactcaacttgctggattactaacaaaaatggtt
aatcctattaatcttgttgcatatgttgatagtagtaaaaattctcaaaaagttattgag
cttttaaatgaagtagcagatcaaagcagcaaaatcactgttatagaaggtgataaaagt
cgcgtaaatcgcaaaccaagtttcgcagtacttaatccacaaactaatgtgtctgtaagc
tttgctggtttacctcttggacacgagtttagctctttagttttagcgattttgcaagta
agcggttacgctcccaaaataagcgatggtcagcgcaaagcaattttgagcattggaagt
catgaagttacaacatacatgtctgttacttgcattaattgcccagaggttgttcaatcg
cttaatacaatttcgattattaatcctaaagtaaaacatattgctgtagaagggagcgct
tttaaagacgaggtagattctcttggcgtaatgagtgttcctgcagtttttgaaaacgga
aagatgatttcttctggaagatcatctatagacgaattagttgcgattcttttaagtcaa
gaggaaaatagcgattcaagcaattctaaggtttctggcgattcttcactagcacaaaaa
atgaacgccaaaaatccgtacgacgttattcttgtaggtggaggccctgctgcaagcgcc
gcagcgatttacacagctagaaaaggccttaaaacagcaatgattatggaccacagaggc
ggtcaagttgttgaaacagaaagcattgaaaatcatatttcgcaaacgcacacaacaggc
gcaaagcttgctaacgatttaacaaaccacattgctcaatatgacattgacgtatttact
cccgattgggctacatctttagatattgctgaagaatcttacggattgcacacaattagt
actaaatctggcggaagcttaaaagctaaagcagtgattattgcaacaggcgctacatgg
agaacacttggcattcctggggaagacgaatatagaaacaagggagtgtcgttctgtccg
cattgcgatggtccattatttaaaaataagaatgttgtagttgttggcggaggaaattct
ggagtcgaagctgcaatagacttagcaggtgttgcaaatcacgttactctaatcgagtat
atgaacacgcttaaagcagatcaaatattagttaatgctctaaataatctttctaatact
actgtaataataggtgctgctcttagttctatagaaggagacggaacaaaggttattgca
gtacgttataaagatcgcaatgctaataatggtgaaaatagtgagaaaattttgcacaca
gacggcgtgtttgttcaaattggtttaatgccaaatactaaatggatttcaaacaaacta
agcttaaataatcgttcggaaatagtaacagatagaaaagggtgcacgagtgttcatggc
atttttgctgctggcgattgcacagatgagccttataagcaaattgttacagcatatgga
tctggagcaaacgcggctcttagtgcattcgactatctaattagaaatgtgtaa

DBGET integrated database retrieval system