KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0734Help
Entry
HMPREF9231_0734   CDS       T01939                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gvh  Gardnerella vaginalis HMP9231
Brite
KEGG Orthology (KO) [BR:gvh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF9231_0734 (ahpF)
Enzymes [BR:gvh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF9231_0734 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Thi4 AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 Trp_halogenase NAD_binding_7 FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AEF31517
LinkDB All DBs
Position
873456..875069
Genome map
AA seq 537 aa AA seqDB search
MSLLDSNLTTQLAGLLTKMVNPINLVAYVDSSKNSQKVIELLNEVADQSSKITVIEGDKS
RVNRKPSFAVLNPQTNVSVSFAGLPLGHEFSSLVLAILQVSGYAPKISDGQRKAILSIGS
HEVTTYMSVTCINCPEVVQSLNTISIINPKVKHIAVEGSAFKDEVDSLGVMSVPAVFENG
KMISSGRSSIDELVAILLSQEENSDSSNSKVSGDSSLAQKMNAKNPYDVILVGGGPAASA
AAIYTARKGLKTAMIMDHRGGQVVETESIENHISQTHTTGAKLANDLTNHIAQYDIDVFT
PDWATSLDIAEESYGLHTISTKSGGSLKAKAVIIATGATWRTLGIPGEDEYRNKGVSFCP
HCDGPLFKNKNVVVVGGGNSGVEAAIDLAGVANHVTLIEYMNTLKADQILVNALNNLSNT
TVITGAALSSIEGDGTKVIAVRYKDRNTNNGENSEKILHTDGVFVQIGLMPNTKWISNKL
SLNNRSEIVTDRKGCTSVHGIFAAGDCTDEPYKQIVTAYGSGANAALSAFDYLIRNV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtctttattggattcaaacttaactactcaacttgctggattactaacaaaaatggtt
aatcctattaatcttgttgcatatgttgatagtagtaaaaattctcaaaaagttattgag
cttttaaatgaagtagcagatcaaagcagcaaaatcactgttatagaaggtgataaaagt
cgcgtaaatcgcaaaccaagtttcgcagtacttaatccacaaactaatgtgtctgtaagc
tttgctggtttacctcttggacacgagtttagctctttagttttagcgattttgcaagta
agcggttacgctcccaaaataagcgatggtcagcgcaaagcaattttgagcattggaagt
catgaagttacaacatacatgtctgttacttgcattaattgcccagaggttgttcaatcg
cttaatacaatttcgattattaatcctaaagtaaaacatattgctgtagaagggagcgct
tttaaagacgaggtagattctcttggcgtaatgagtgttcctgcagtttttgaaaacgga
aaaatgatttcttctggaagatcatctatagacgaattagttgcgattcttttaagtcaa
gaggaaaatagcgattcaagcaattctaaggtttctggcgattcttcactagcgcaaaaa
atgaacgccaaaaatccgtacgacgttattcttgtaggtggaggccctgctgcaagcgcc
gcagcgatttacacagctagaaaaggccttaaaacagcaatgattatggaccacagaggc
ggtcaagttgttgaaacagaaagcattgaaaatcatatttcgcaaacgcacacaacaggc
gcaaagcttgctaacgatttaacaaaccacattgctcaatatgacattgacgtatttact
cccgattgggctacatctttagatattgctgaagaatcttacggattgcacacaattagt
actaaatctggcggaagcttaaaagctaaagcagtgattattgcaacaggcgctacatgg
agaacacttggcattcctggggaagacgaatatagaaacaagggagtgtcgttctgcccg
cattgcgatggtccattatttaaaaataagaatgttgtagttgttggcggaggaaattct
ggagtcgaagctgcaatagacttagcaggtgttgcaaatcacgttactctaatcgagtat
atgaacacgcttaaagcagatcaaatattagttaatgctctaaataatctttctaatact
actgtaataacaggtgctgctcttagttctatagaaggagacggaacaaaggttattgca
gtacgttataaagatcgcaatactaataatggtgaaaatagtgagaaaattttgcacaca
gacggcgtgtttgttcaaattggtttaatgccaaatactaaatggatttcaaacaaacta
agcttaaataatcgttcggaaatagtaacagatagaaaagggtgcacgagtgttcatggc
atttttgctgctggcgattgcacagatgagccttataagcaaattgttacagcatatgga
tctggagcaaacgcggctcttagtgcattcgactatctaattagaaatgtgtaa

DBGET integrated database retrieval system