KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1211Help
Entry
HMPREF9231_1211   CDS       T01939                                 

Gene name
infB
Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
gvh  Gardnerella vaginalis HMP9231
Brite
KEGG Orthology (KO) [BR:gvh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gvh03012]
    HMPREF9231_1211 (infB)
   03029 Mitochondrial biogenesis [BR:gvh03029]
    HMPREF9231_1211 (infB)
Translation factors [BR:gvh03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    HMPREF9231_1211 (infB)
 Prokaryotic type
   HMPREF9231_1211 (infB)
Mitochondrial biogenesis [BR:gvh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HMPREF9231_1211 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N GTP_EFTU_D2 Ras MMR_HSR1 Roc MMR_HSR1_Xtn Arf
Motif
Other DBs
NCBI-ProteinID: AEF31086
LinkDB All DBs
Position
complement(1466304..1469237)
Genome map
AA seq 977 aa AA seqDB search
MVKKRVYELAKEFGVDSKTVLERLKSMGEFVKSASSTVEAPVARRLKTEFASAGSSSGSS
AAKNDAKPAANKNADNSSNKTNHSSNKSESLAQNNAEKRNLDKSSEKASEKQHSSQKSHD
NHDNSDNKENHSSSTLNGVIPKPSAGHVKPHAIANADSKRGGDKRGENRNDARGDKRGEN
RSSKSDRSSQMPPRPRPHQGAGSGSAPRPGNNPFSRKQGMRAPTPGDIPRPHPMSRPGAA
AENSRGAKPGQGGGNGNGGGRGRGGRGGARQGGGNGSNRSSQWSGSHRQGGGSGASSRPS
AESRFNANQAASFQAAAAGAPNAGPSRGSGRGRAGAAGAFGRQGGKSSKARKNRLAKRRE
YEELKAPVIGGVRIPSGNGATIRLRQGATLSDLAEKIDVNPAALVTVLFHLGEMATATQS
LDETTFQILGEEIGWNINLVSAEEEDKELLQQFDIDLDEEELQEDDNLVTRPPVVTVMGH
VDHGKTRLLDTIRKSNVVAREAGGITQRIGAYQVTVTLDGDKRKITFLDTPGHEAFTAMR
ARGAELTDVAILVVAADDGVMPQTVEAINHAQAAHVPIVVAVNKIDVAGANPDKVRGQLT
EYGLVPEEYGGDTMFVDISAKQGTNVDKLLEAVILTTDAELDPKANPNMDARGATVEARL
DKGRGAVATVLVQQGTLKVGDSIVAGTSYGRVRAMLDENGNHLQEAGPSTPVQVLGLTSV
PTAGDLFLVTSDDRSARQIAEKRQATERAAQLAKRRKVVSLESLKEQFAKSEVDMLNIVI
KGDSSGSVEALEDSLMKIEVSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNR
QVADLADREGVEVKYYSVIYKAIEDIEAALKGMLKPEFEEVVTSHSEIREIFRSSKFGNI
AGVMVQDGEVKRGTKCRILRNGVATVNDLEISSLRRFKDDVQSVSEGYEAGINLGSFNDI
ELGDIIETFEMKQIERK
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaaaagcgcgtatacgaactagctaaagagtttggtgtagacagcaaaaccgtg
ttggagcggttgaagagcatgggcgaatttgttaagtccgcgtcttcaacagtagaggct
cctgttgcacgtagattaaaaacagagtttgcgtccgctggatcatcttctggatcgtct
gctgcaaagaatgatgcgaaacctgctgcaaataagaatgctgataattcttcgaataag
actaatcattcttctaataaatcggagtcgttggctcagaataatgctgaaaaacgaaat
ttggataagtcttcagaaaaagcttcggaaaaacagcattcttcgcaaaagtcacatgat
aatcatgataatagtgacaataaagaaaatcattcatcttccactctaaatggtgtaatt
cctaagccttctgctggtcacgtaaagccacatgctatcgctaacgctgattctaagcgt
ggaggcgataagcgtggcgaaaatcgtaacgatgcacgaggcgataagcgcggggaaaat
cgttcttctaagtcagatcgttcttctcagatgcctccacgccctcgtccgcatcagggt
gctggctctggttctgctcctcgtccaggtaataatccgttcagccgaaagcaaggtatg
cgcgctcctacacctggtgatattcctcgtcctcacccaatgtcacgtccaggcgctgct
gcagaaaattctcgtggagcaaagcctggtcagggcggcggtaatggcaacggcggtggt
cgcggtcgcggtggtcgcggaggcgctcgtcagggcggcggtaatggttcgaaccgctct
tcgcagtggtctggttcacatcgtcagggtggcggtagtggcgcaagctctcgtccgtct
gcagaatcgcgctttaatgcaaatcaggctgcaagcttccaagctgcggctgcaggcgct
ccaaatgctggtccatctcgtggcagtggtcgcggtcgcgcaggtgctgcaggcgcattt
ggtcgtcagggtggaaagtcctctaaggctcgcaagaatcgtcttgcaaagcgcagagaa
tacgaagagcttaaagcaccagtgattggcggcgtgcgtattccttctggaaatggcgct
acgattcgacttcgtcaaggtgcaacgctttctgatttggcagaaaagattgatgtaaat
ccagctgctttggtaaccgttttgttccatcttggagaaatggctacagctactcagtct
ttggatgaaacaacattccagattcttggcgaagaaatcggttggaatatcaatctcgtt
tctgcagaagaagaagataaagagcttcttcaacagttcgacattgatttggatgaagaa
gaacttcaagaagacgataatcttgtaactcgtcctccagttgttactgttatgggtcac
gttgaccatggtaaaactcgtttgcttgatactattcgtaagtcgaatgttgtagctcga
gaagctggtggaattactcagcgtattggcgcttaccaggttacggttactttagatgga
gacaagcgcaagattacgttcttggataccccaggccacgaagcgtttactgctatgcgt
gctcgtggtgcagagcttacagacgttgcaattcttgttgttgcagcagacgacggcgtt
atgcctcaaactgttgaggcaatcaaccacgctcaggctgctcacgtgcctattgttgtg
gctgtaaacaagattgatgttgctggagcaaacccagataaggtgcgcggtcagcttaca
gagtacggtcttgtgccagaagaatacggcggtgacaccatgtttgtggatatttccgca
aagcagggaactaacgtagataagcttcttgaggctgttattttgacaactgacgctgag
cttgatcctaaggcaaatccaaacatggatgctcgtggtgcaaccgttgaagctcgactt
gataagggtcgtggcgctgttgctactgttcttgttcagcaaggcactcttaaagtcgga
gattctattgttgcaggtacgtcttatggtcgtgttcgcgcaatgctcgacgaaaatggc
aaccacttgcaagaggcaggtccttctacgccagttcaggtgcttggtttgacttctgtt
ccaactgcaggagacttgttcttagtcacatccgacgatcgttccgctcgtcagattgcc
gaaaagcgccaagctacagagcgtgcagctcagcttgctaagcgtcgcaaggttgtgtct
cttgaaagccttaaggaacagttcgctaagtccgaagtggatatgctcaacattgttatt
aagggcgattcttctggttctgttgaggctttggaagattccttgatgaagattgaggtt
tccgacgaagttggaattcaggttattcaccgcggtgttggtgcaattactcagaatgat
gtgaacttggcaacagttgataaggctgtgattattggcttcaacgtgcgtccaaaccgt
caggttgccgatttggcagaccgcgagggcgtggaagtcaagtactactcggttatttac
aaggctatcgaagatattgaagctgctttgaagggtatgcttaagccagagtttgaagag
gttgttacttctcactctgagattcgtgaaatcttccgttcttccaagtttggcaatatt
gctggtgttatggttcaagacggcgaagttaagcgcggtacaaagtgccgtattttgcgt
aacggtgttgctactgttaacgatcttgaaatctccagcttgcgtagattcaaggatgat
gttcaatccgttagcgaaggctacgaggcaggcattaaccttggcagctttaacgacatt
gagcttggcgatataatcgaaacctttgaaatgaagcagattgagcgcaagtaa

DBGET integrated database retrieval system